Recombinant Human NENF protein, His-tagged
| Cat.No. : | NENF-1263H |
| Product Overview : | Recombinant Human NENF protein(33-172 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | July 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 33-172 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | QTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NENF neudesin neurotrophic factor [ Homo sapiens ] |
| Official Symbol | NENF |
| Synonyms | NENF; neudesin neurotrophic factor; neuron derived neurotrophic factor; neudesin; CIR2; SCIRP10; SPUF; SCIRP10-related protein; cell growth-inhibiting protein 47; neuron-derived neurotrophic factor; secreted protein of unknown function; Spinal cord injury related protein 10; cell immortalization-related protein 2; |
| Gene ID | 29937 |
| mRNA Refseq | NM_013349 |
| Protein Refseq | NP_037481 |
| MIM | 611874 |
| UniProt ID | Q9UMX5 |
| ◆ Recombinant Proteins | ||
| NENF-1263H | Recombinant Human NENF protein, His-tagged | +Inquiry |
| NENF-4227H | Recombinant Human NENF Protein (Gly32-Phe172), N-His tagged | +Inquiry |
| NENF-6015M | Recombinant Mouse NENF Protein, His (Fc)-Avi-tagged | +Inquiry |
| NENF-6190H | Recombinant Human NENF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NENF-3596Z | Recombinant Zebrafish NENF | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NENF Products
Required fields are marked with *
My Review for All NENF Products
Required fields are marked with *
