Recombinant Human NENF protein, His-tagged
Cat.No. : | NENF-1263H |
Product Overview : | Recombinant Human NENF protein(33-172 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 33-172 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | QTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NENF neudesin neurotrophic factor [ Homo sapiens ] |
Official Symbol | NENF |
Synonyms | NENF; neudesin neurotrophic factor; neuron derived neurotrophic factor; neudesin; CIR2; SCIRP10; SPUF; SCIRP10-related protein; cell growth-inhibiting protein 47; neuron-derived neurotrophic factor; secreted protein of unknown function; Spinal cord injury related protein 10; cell immortalization-related protein 2; |
Gene ID | 29937 |
mRNA Refseq | NM_013349 |
Protein Refseq | NP_037481 |
MIM | 611874 |
UniProt ID | Q9UMX5 |
◆ Recombinant Proteins | ||
NENF-3616R | Recombinant Rat NENF Protein, His (Fc)-Avi-tagged | +Inquiry |
Nenf-4375M | Recombinant Mouse Nenf Protein, Myc/DDK-tagged | +Inquiry |
NENF-6015M | Recombinant Mouse NENF Protein, His (Fc)-Avi-tagged | +Inquiry |
NENF-1263H | Recombinant Human NENF protein, His-tagged | +Inquiry |
NENF-764H | Recombinant Human NENF Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NENF Products
Required fields are marked with *
My Review for All NENF Products
Required fields are marked with *