Recombinant Human NMB Protein, His-tagged

• Cat.No.: NMB-208H
• Product Overview: Recombinant Human NMB Protein with His tag was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 25-121 aa
• Description: This gene encodes a member of the bombesin-like family of neuropeptides, which negatively regulate eating behavior. The encoded protein may regulate colonic smooth muscle contraction through binding to its cognate receptor, the neuromedin B receptor (NMBR). Polymorphisms of this gene may be associated with hunger, weight gain and obesity. Alternative splicing results in multiple transcript variants.
• Form: Sterile PBS, pH8.0, 0.25% SKL
• Molecular Mass: 12 kDa
• AASequence: MAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQKGGGGSHHHHHHHH
• Endotoxin: <1 EU/μg determined by LAL method
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: NMB neuromedin B [ Homo sapiens (human) ]
• Official Symbol: NMB
• Synonyms: NMB; neuromedin B; neuromedin-B; MGC2277; MGC3936; MGC17211
• Gene ID: 4828
• mRNA Refseq: NM_021077
• Protein Refseq: NP_066563
• MIM: 162340
• UniProt ID: P08949