Recombinant Full Length Human NMB Protein, GST-tagged
Cat.No. : | NMB-6756HF |
Product Overview : | Human NMB full-length ORF ( AAH08603, 25 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 121 amino acids |
Description : | This gene encodes a member of the bombesin-like family of neuropeptides, which negatively regulate eating behavior. The encoded protein may regulate colonic smooth muscle contraction through binding to its cognate receptor, the neuromedin B receptor (NMBR). Polymorphisms of this gene may be associated with hunger, weight gain and obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015] |
Molecular Mass : | 36.41 kDa |
AA Sequence : | APLSWDLPEPRSRASEIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTATHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NMB neuromedin B [ Homo sapiens ] |
Official Symbol | NMB |
Synonyms | NMB; neuromedin B; neuromedin-B; MGC2277; MGC3936; MGC17211; |
Gene ID | 4828 |
mRNA Refseq | NM_021077 |
Protein Refseq | NP_066563 |
MIM | 162340 |
UniProt ID | P08949 |
◆ Recombinant Proteins | ||
NMB-208H | Recombinant Human neuromedin B, His-tagged | +Inquiry |
NMB-10735M | Recombinant Mouse NMB Protein | +Inquiry |
NMB-4707H | Recombinant Human NMB Protein (Ala25-Lys121), N-GST tagged | +Inquiry |
NMB-2825H | Recombinant Human NMB Protein, His-tagged, OVA Conjugated | +Inquiry |
NMB-6105M | Recombinant Mouse NMB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMB-3795HCL | Recombinant Human NMB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMB Products
Required fields are marked with *
My Review for All NMB Products
Required fields are marked with *
0
Inquiry Basket