Recombinant Human NMB Protein, GST-tagged

Cat.No. : NMB-5922H
Product Overview : Human NMB full-length ORF ( AAH08603, 25 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the bombesin-like family of neuropeptides, which negatively regulate eating behavior. The encoded protein may regulate colonic smooth muscle contraction through binding to its cognate receptor, the neuromedin B receptor (NMBR). Polymorphisms of this gene may be associated with hunger, weight gain and obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
Molecular Mass : 36.41 kDa
AA Sequence : APLSWDLPEPRSRASEIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTATHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NMB neuromedin B [ Homo sapiens ]
Official Symbol NMB
Synonyms NMB; neuromedin B; neuromedin-B; MGC2277; MGC3936; MGC17211;
Gene ID 4828
mRNA Refseq NM_021077
Protein Refseq NP_066563
MIM 162340
UniProt ID P08949

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NMB Products

Required fields are marked with *

My Review for All NMB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon