Recombinant Human NF2 protein, GST-tagged

Cat.No. : NF2-22H
Product Overview : Recombinant Human NF2(1 a.a. - 82 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-82 a.a.
Description : This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 34.76 kDa
AA Sequence : MVVSLRALLLALRQKPHSTGTIHEVTAQLMMSVRLSFWPVAVCSCVAQMASFILIKAPPQPQQSPQPVLSTLLFMYLPGPAR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name NF2 neurofibromin 2 (merlin) [ Homo sapiens ]
Official Symbol NF2
Synonyms NF2; neurofibromin 2 (merlin); neurofibromin 2 (bilateral acoustic neuroma); merlin; moesin ezrin radixin like; schwannomin; schwannomerlin; neurofibromin-2; moesin-ezrin-radixin like; moesin-ezrin-radixin-like protein; moesin-ezrin-radizin-like protein; ACN; SCH; BANF;
Gene ID 4771
mRNA Refseq NM_000268
Protein Refseq NP_000259
MIM 607379
UniProt ID P35240
Chromosome Location 22q12.2
Pathway ErbB2/ErbB3 signaling events, organism-specific biosystem;
Function cytoskeletal protein binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NF2 Products

Required fields are marked with *

My Review for All NF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon