Recombinant Human NF2 protein, GST-tagged
Cat.No. : | NF2-22H |
Product Overview : | Recombinant Human NF2(1 a.a. - 82 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-82 a.a. |
Description : | This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 34.76 kDa |
AA Sequence : | MVVSLRALLLALRQKPHSTGTIHEVTAQLMMSVRLSFWPVAVCSCVAQMASFILIKAPPQPQQSPQPVLSTLLFMYLPGPAR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NF2 neurofibromin 2 (merlin) [ Homo sapiens ] |
Official Symbol | NF2 |
Synonyms | NF2; neurofibromin 2 (merlin); neurofibromin 2 (bilateral acoustic neuroma); merlin; moesin ezrin radixin like; schwannomin; schwannomerlin; neurofibromin-2; moesin-ezrin-radixin like; moesin-ezrin-radixin-like protein; moesin-ezrin-radizin-like protein; ACN; SCH; BANF; |
Gene ID | 4771 |
mRNA Refseq | NM_000268 |
Protein Refseq | NP_000259 |
MIM | 607379 |
UniProt ID | P35240 |
Chromosome Location | 22q12.2 |
Pathway | ErbB2/ErbB3 signaling events, organism-specific biosystem; |
Function | cytoskeletal protein binding; protein binding; |
◆ Recombinant Proteins | ||
NF2-3273H | Recombinant Human NF2 protein, His-tagged | +Inquiry |
NF2-747H | Recombinant Human NF2 Protein, His-tagged | +Inquiry |
Nf2-2000M | Recombinant Mouse Nf2 protein, His & T7-tagged | +Inquiry |
NF2-6029M | Recombinant Mouse NF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NF2-001H | Recombinant Human NF2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NF2-3861HCL | Recombinant Human NF2 293 Cell Lysate | +Inquiry |
NF2-3862HCL | Recombinant Human NF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NF2 Products
Required fields are marked with *
My Review for All NF2 Products
Required fields are marked with *
0
Inquiry Basket