Recombinant Human NFASC Protein (1239-1347 aa), His-tagged

• Cat.No.: NFASC-682H
• Product Overview: Recombinant Human NFASC Protein (1239-1347 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1239-1347 aa
• Description: Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 15.9 kDa
• AA Sequence: KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: NFASC neurofascin [ Homo sapiens ]
• Official Symbol: NFASC
• Synonyms: NFASC; neurofascin; FLJ46866; KIAA0756; NF; NRCAML; DKFZp686P2250
• Gene ID: 23114
• mRNA Refseq: NM_001005388
• Protein Refseq: NP_001005388
• MIM: 609145
• UniProt ID: O94856