Recombinant Human NFASC Protein (1239-1347 aa), His-tagged
| Cat.No. : | NFASC-682H |
| Product Overview : | Recombinant Human NFASC Protein (1239-1347 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1239-1347 aa |
| Description : | Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 15.9 kDa |
| AA Sequence : | KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | NFASC neurofascin [ Homo sapiens ] |
| Official Symbol | NFASC |
| Synonyms | NFASC; neurofascin; FLJ46866; KIAA0756; NF; NRCAML; DKFZp686P2250; |
| Gene ID | 23114 |
| mRNA Refseq | NM_001005388 |
| Protein Refseq | NP_001005388 |
| MIM | 609145 |
| UniProt ID | O94856 |
| ◆ Recombinant Proteins | ||
| NFASC-236H | Recombinant Human NFASC, His tagged | +Inquiry |
| NFASC-2687H | Recombinant Human NFASC protein, His-tagged | +Inquiry |
| NFASC-689H | Active Recombinant Human NFASC Protein, His-tagged | +Inquiry |
| NFASC-3968R | Recombinant Rat NFASC Protein | +Inquiry |
| Nfasc-4386M | Recombinant Mouse Nfasc Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFASC Products
Required fields are marked with *
My Review for All NFASC Products
Required fields are marked with *
