Recombinant Human NFASC Protein (1239-1347 aa), His-tagged

Cat.No. : NFASC-682H
Product Overview : Recombinant Human NFASC Protein (1239-1347 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1239-1347 aa
Description : Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 15.9 kDa
AA Sequence : KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name NFASC neurofascin [ Homo sapiens ]
Official Symbol NFASC
Synonyms NFASC; neurofascin; FLJ46866; KIAA0756; NF; NRCAML; DKFZp686P2250;
Gene ID 23114
mRNA Refseq NM_001005388
Protein Refseq NP_001005388
MIM 609145
UniProt ID O94856

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFASC Products

Required fields are marked with *

My Review for All NFASC Products

Required fields are marked with *

0
cart-icon