Recombinant Human NFASC protein, His-tagged
| Cat.No. : | NFASC-2687H |
| Product Overview : | Recombinant Human NFASC protein(74-185 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 74-185 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | RFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NFASC neurofascin [ Homo sapiens ] |
| Official Symbol | NFASC |
| Synonyms | NFASC; neurofascin; neurofascin homolog (chicken); FLJ46866; KIAA0756; NF; NRCAML; neurofascin homolog; DKFZp686P2250; |
| Gene ID | 23114 |
| mRNA Refseq | NM_001005388 |
| Protein Refseq | NP_001005388 |
| MIM | 609145 |
| UniProt ID | O94856 |
| ◆ Recombinant Proteins | ||
| NFASC-596H | Recombinant Human NFASC Protein, GST-tagged | +Inquiry |
| NFASC-2687H | Recombinant Human NFASC protein, His-tagged | +Inquiry |
| NFASC-689H | Active Recombinant Human NFASC Protein, His-tagged | +Inquiry |
| NFASC-682H | Recombinant Human NFASC Protein (1239-1347 aa), His-tagged | +Inquiry |
| NFASC-749H | Recombinant Human NFASC Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFASC Products
Required fields are marked with *
My Review for All NFASC Products
Required fields are marked with *
