"NFASC" Related Products

Expand
Expand

Recombinant Human NFASC Protein, GST-tagged

Cat.No.: NFASC-596H
Product Overview: Recombinant Human NFASC(661 a.a. - 758 a.a.) fused with GST tag at the N-terminus was produced in Wheat Germ.
Description: This gene encodes an L1 family immunoglobulin cell adhesion molecule with multiple IGcam and fibronectin domains. The protein functions in neurite outgrowth, neurite fasciculation, and organization of the axon initial segment (AIS) and nodes of Ranvier on axons during early development. Both the AIS and nodes of Ranvier contain high densities of voltage-gated Na+ (Nav) channels which are clustered by interactions with cytoskeletal and scaffolding proteins including this protein, gliomedin, ankyrin 3 (ankyrin-G), and betaIV spectrin. This protein links the AIS extracellular matrix to the intracellular cytoskeleton. This gene undergoes extensive alternative splicing, and the full-length nature of some variants has not been determined.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.52 kDa
Protein length: 661 a.a. - 758 a.a.
AA sequence: KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: NFASC neurofascin [ Homo sapiens ]
Official Symbol: NFASC
Synonyms: NFASC; neurofascin; neurofascin homolog (chicken); FLJ46866; KIAA0756; NF; NRCAML; neurofascin homolog; DKFZp686P2250;
Gene ID: 23114
mRNA Refseq: NM_001005388
Protein Refseq: NP_001005388
MIM: 609145
UniProt ID: O94856

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.