Recombinant Human NFASC Protein, GST-tagged
Cat.No. : | NFASC-596H |
Product Overview : | Recombinant Human NFASC(661 a.a. - 758 a.a.) fused with GST tag at the N-terminus was produced in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 661 a.a. - 758 a.a. |
Description : | This gene encodes an L1 family immunoglobulin cell adhesion molecule with multiple IGcam and fibronectin domains. The protein functions in neurite outgrowth, neurite fasciculation, and organization of the axon initial segment (AIS) and nodes of Ranvier on axons during early development. Both the AIS and nodes of Ranvier contain high densities of voltage-gated Na+ (Nav) channels which are clustered by interactions with cytoskeletal and scaffolding proteins including this protein, gliomedin, ankyrin 3 (ankyrin-G), and betaIV spectrin. This protein links the AIS extracellular matrix to the intracellular cytoskeleton. This gene undergoes extensive alternative splicing, and the full-length nature of some variants has not been determined. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA sequence : | KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NFASC neurofascin [ Homo sapiens ] |
Official Symbol | NFASC |
Synonyms | NFASC; neurofascin; neurofascin homolog (chicken); FLJ46866; KIAA0756; NF; NRCAML; neurofascin homolog; DKFZp686P2250; |
Gene ID | 23114 |
mRNA Refseq | NM_001005388 |
Protein Refseq | NP_001005388 |
MIM | 609145 |
UniProt ID | O94856 |
◆ Recombinant Proteins | ||
NFASC-621H | Recombinant Human NFASC Protein (Met1-Gln939), HIgG1 Fc-tagged, Biotinylated | +Inquiry |
NFASC-682H | Recombinant Human NFASC Protein (1239-1347 aa), His-tagged | +Inquiry |
NFASC-2489H | Recombinant Human NFASC protein(1241-1330 aa), C-His-tagged | +Inquiry |
Nfasc-4386M | Recombinant Mouse Nfasc Protein, Myc/DDK-tagged | +Inquiry |
NFASC-236H | Recombinant Human NFASC, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFASC Products
Required fields are marked with *
My Review for All NFASC Products
Required fields are marked with *
0
Inquiry Basket