Recombinant Human NFAT5

Cat.No. : NFAT5-30376TH
Product Overview : Recombinant fragment corresponding to amino acids 1422-1531 of Human NFAT5 protein with a proprietary tag; predicted mwt: 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.730kDa
Tissue specificity : Highest levels in skeletal muscle, brain, heart and peripheral blood leukocytes. Also expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
Sequence Similarities : Contains 1 RHD (Rel-like) domain.
Gene Name NFAT5 nuclear factor of activated T-cells 5, tonicity-responsive [ Homo sapiens ]
Official Symbol NFAT5
Synonyms NFAT5; nuclear factor of activated T-cells 5, tonicity-responsive; nuclear factor of activated T-cells 5; KIAA0827; NF AT5; NFATL1; NFATZ; OREBP; TONEBP;
Gene ID 10725
mRNA Refseq NM_001113178
Protein Refseq NP_001106649
MIM 604708
Uniprot ID O94916
Chromosome Location 16q22.1
Pathway Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; HTLV-I infection, organism-specific biosystem;
Function DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFAT5 Products

Required fields are marked with *

My Review for All NFAT5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon