Recombinant Human NFAT5
Cat.No. : | NFAT5-30376TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1422-1531 of Human NFAT5 protein with a proprietary tag; predicted mwt: 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.730kDa |
Tissue specificity : | Highest levels in skeletal muscle, brain, heart and peripheral blood leukocytes. Also expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine and colon. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FHNTAGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF |
Sequence Similarities : | Contains 1 RHD (Rel-like) domain. |
Gene Name | NFAT5 nuclear factor of activated T-cells 5, tonicity-responsive [ Homo sapiens ] |
Official Symbol | NFAT5 |
Synonyms | NFAT5; nuclear factor of activated T-cells 5, tonicity-responsive; nuclear factor of activated T-cells 5; KIAA0827; NF AT5; NFATL1; NFATZ; OREBP; TONEBP; |
Gene ID | 10725 |
mRNA Refseq | NM_001113178 |
Protein Refseq | NP_001106649 |
MIM | 604708 |
Uniprot ID | O94916 |
Chromosome Location | 16q22.1 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; HTLV-I infection, organism-specific biosystem; |
Function | DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
NFAT5-4235C | Recombinant Chicken NFAT5 | +Inquiry |
NFAT5-1187HCL | Recombinant Human NFAT5 cell lysate | +Inquiry |
NFAT5-30376TH | Recombinant Human NFAT5 | +Inquiry |
NFAT5-3628R | Recombinant Rat NFAT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
NFAT5-3969R | Recombinant Rat NFAT5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFAT5 Products
Required fields are marked with *
My Review for All NFAT5 Products
Required fields are marked with *