Recombinant Human NFATC3 Protein, His-tagged
| Cat.No. : | NFATC3-01H |
| Product Overview : | Recombinant Human NFATC3 Protein, His-tagged,expressed in E. coli. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 900-1035 aa |
| Tag : | C-His |
| Molecular Mass : | 15 kDa |
| AA Sequence : | MDQITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| Gene Name | NFATC3 nuclear factor of activated T cells 3 [ Homo sapiens (human) ] |
| Official Symbol | NFATC3 |
| Synonyms | NFAT4,NFATX, NF-AT4c,n339260,NFATC3 |
| Gene ID | 4775 |
| MIM | 602698 |
| UniProt ID | Q12968 |
| ◆ Recombinant Proteins | ||
| NFATC3-5888H | Recombinant Human NFATC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NFATC3-29252TH | Recombinant Human NFATC3 | +Inquiry |
| NFATC3-339HF | Recombinant Full Length Human NFATC3 Protein | +Inquiry |
| Nfatc3-4389M | Recombinant Mouse Nfatc3 Protein, Myc/DDK-tagged | +Inquiry |
| NFATC3-27538TH | Recombinant Human NFATC3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFATC3-3856HCL | Recombinant Human NFATC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFATC3 Products
Required fields are marked with *
My Review for All NFATC3 Products
Required fields are marked with *
