Recombinant Human NFATC3 Protein, His-tagged
Cat.No. : | NFATC3-01H |
Product Overview : | Recombinant Human NFATC3 Protein, His-tagged,expressed in E. coli. |
Availability | October 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 900-1035 aa |
Tag : | C-His |
Molecular Mass : | 15 kDa |
AA Sequence : | MDQITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
Gene Name | NFATC3 nuclear factor of activated T cells 3 [ Homo sapiens (human) ] |
Official Symbol | NFATC3 |
Synonyms | NFAT4,NFATX, NF-AT4c,n339260,NFATC3 |
Gene ID | 4775 |
MIM | 602698 |
UniProt ID | Q12968 |
◆ Recombinant Proteins | ||
NFATC3-339HF | Recombinant Full Length Human NFATC3 Protein | +Inquiry |
Nfatc3-4389M | Recombinant Mouse Nfatc3 Protein, Myc/DDK-tagged | +Inquiry |
NFATC3-236H | Recombinant Human NFATC3 Protein, MYC/DDK-tagged | +Inquiry |
NFATC3-29252TH | Recombinant Human NFATC3 | +Inquiry |
NFATC3-27538TH | Recombinant Human NFATC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFATC3-3856HCL | Recombinant Human NFATC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFATC3 Products
Required fields are marked with *
My Review for All NFATC3 Products
Required fields are marked with *