"NFE2" Related Products

Expand
Expand
Expand

Recombinant Human NFE2 protein, Arginine-tagged

Cat.No.: NFE2-171H
Product Overview: Recombinant human NFE2 cDNA (373aa, derived from BC005044) protein fused with T7-His-TEV cleavage site Tag at N-terminal and 11 arginine domain (11R) at C-terminal, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPS FEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQD PLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLP AAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRR RGKNKVAAQNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSP EEYALQQAADGTIFLVPRGTKMEATDLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name: NFE2 nuclear factor (erythroid-derived 2), 45kDa [ Homo sapiens ]
Official Symbol: NFE2
Synonyms: NFE2; NF E2; p45 NF-E2; leucine zipper protein NF-E2; nuclear factor, erythroid-derived 2 45 kDa subunit; p45; NF-E2;
Gene ID: 4778
mRNA Refseq: NM_001136023
Protein Refseq: NP_001129495
MIM: 601490
UniProt ID: Q16621
Chromosome Location: 12q13
Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function: WW domain binding; WW domain binding; protein N-terminus binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.