Recombinant Human NFE2 protein, Arginine-tagged
| Cat.No. : | NFE2-171H |
| Product Overview : | Recombinant human NFE2 cDNA (373aa, derived from BC005044) protein fused with T7-His-TEV cleavage site Tag at N-terminal and 11 arginine domain (11R) at C-terminal, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPS FEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQD PLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLP AAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRR RGKNKVAAQNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSP EEYALQQAADGTIFLVPRGTKMEATDLEESGGGGSPGRRRRRRRRRRR |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days |
| Gene Name | NFE2 nuclear factor (erythroid-derived 2), 45kDa [ Homo sapiens ] |
| Official Symbol | NFE2 |
| Synonyms | NFE2; NF E2; p45 NF-E2; leucine zipper protein NF-E2; nuclear factor, erythroid-derived 2 45 kDa subunit; p45; NF-E2; |
| Gene ID | 4778 |
| mRNA Refseq | NM_001136023 |
| Protein Refseq | NP_001129495 |
| MIM | 601490 |
| UniProt ID | Q16621 |
| Chromosome Location | 12q13 |
| Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
| Function | WW domain binding; WW domain binding; protein N-terminus binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
| ◆ Recombinant Proteins | ||
| NFE2-6032M | Recombinant Mouse NFE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NFE2-341HF | Recombinant Full Length Human NFE2 Protein | +Inquiry |
| NFE2-171H | Recombinant Human NFE2 protein, Arginine-tagged | +Inquiry |
| NFE2-3971R | Recombinant Rat NFE2 Protein | +Inquiry |
| NFE2-4561H | Recombinant Human NFE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFE2-3855HCL | Recombinant Human NFE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFE2 Products
Required fields are marked with *
My Review for All NFE2 Products
Required fields are marked with *



