Recombinant Human NFE2 protein, Arginine-tagged

• Cat.No.: NFE2-171H
• Product Overview: Recombinant human NFE2 cDNA (373aa, derived from BC005044) protein fused with T7-His-TEV cleavage site Tag at N-terminal and 11 arginine domain (11R) at C-terminal, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPS FEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQD PLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLP AAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRR RGKNKVAAQNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSP EEYALQQAADGTIFLVPRGTKMEATDLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days

Gene Information

• Gene Name: NFE2 nuclear factor (erythroid-derived 2), 45kDa [ Homo sapiens ]
• Official Symbol: NFE2
• Synonyms: NFE2; NF E2; p45 NF-E2; leucine zipper protein NF-E2; nuclear factor, erythroid-derived 2 45 kDa subunit; p45; NF-E2
• Gene ID: 4778
• mRNA Refseq: NM_001136023
• Protein Refseq: NP_001129495
• MIM: 601490
• UniProt ID: Q16621
• Chromosome Location: 12q13
• Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem
• Function: WW domain binding; WW domain binding; protein N-terminus binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity