Recombinant Human NFE2 protein, Arginine-tagged
Cat.No. : | NFE2-171H |
Product Overview : | Recombinant human NFE2 cDNA (373aa, derived from BC005044) protein fused with T7-His-TEV cleavage site Tag at N-terminal and 11 arginine domain (11R) at C-terminal, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPS FEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQD PLALLDIGLPAGPPKPQEDPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLP AAETPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRR RGKNKVAAQNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSP EEYALQQAADGTIFLVPRGTKMEATDLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days |
Gene Name | NFE2 nuclear factor (erythroid-derived 2), 45kDa [ Homo sapiens ] |
Official Symbol | NFE2 |
Synonyms | NFE2; NF E2; p45 NF-E2; leucine zipper protein NF-E2; nuclear factor, erythroid-derived 2 45 kDa subunit; p45; NF-E2; |
Gene ID | 4778 |
mRNA Refseq | NM_001136023 |
Protein Refseq | NP_001129495 |
MIM | 601490 |
UniProt ID | Q16621 |
Chromosome Location | 12q13 |
Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function | WW domain binding; WW domain binding; protein N-terminus binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
◆ Recombinant Proteins | ||
NFE2-6032M | Recombinant Mouse NFE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NFE2-3011R | Recombinant Rhesus monkey NFE2 Protein, His-tagged | +Inquiry |
NFE2-10614M | Recombinant Mouse NFE2 Protein | +Inquiry |
NFE2-4561H | Recombinant Human NFE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NFE2-2830R | Recombinant Rhesus Macaque NFE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFE2-3855HCL | Recombinant Human NFE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFE2 Products
Required fields are marked with *
My Review for All NFE2 Products
Required fields are marked with *
0
Inquiry Basket