Recombinant Human NFE2L3 protein, His-tagged
Cat.No. : | NFE2L3-6744H |
Product Overview : | Recombinant Human NFE2L3 protein(), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | LHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGSADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQVPDAGGCASEENGVLREKHEAVDHSSQHEENEERVSAQKENSLQQNDDDENKIAEKPDWEAEKTTESRNERHLNGTDT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NFE2L3 nuclear factor (erythroid-derived 2)-like 3 [ Homo sapiens ] |
Official Symbol | NFE2L3 |
Synonyms | NFE2L3; nuclear factor (erythroid-derived 2)-like 3; nuclear factor erythroid 2-related factor 3; Nrf3; NFE2-related factor 3; NF-E2-related factor 3; nuclear factor, erythroid derived 2, like 3; nuclear factor-erythroid 2-related factor 3; nuclear factor-erythroid 2 p45-related factor 3; NRF3; |
Gene ID | 9603 |
mRNA Refseq | NM_004289 |
Protein Refseq | NP_004280 |
MIM | 604135 |
UniProt ID | Q9Y4A8 |
◆ Recombinant Proteins | ||
NFE2L3-12433Z | Recombinant Zebrafish NFE2L3 | +Inquiry |
NFE2L3-3386H | Recombinant Human NFE2L3 protein, His-tagged | +Inquiry |
NFE2L3-1277H | Recombinant Human NFE2L3, GST-tagged | +Inquiry |
NFE2L3-187H | Recombinant Human NFE2L3 Protein, His-tagged | +Inquiry |
NFE2L3-6744H | Recombinant Human NFE2L3 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFE2L3 Products
Required fields are marked with *
My Review for All NFE2L3 Products
Required fields are marked with *