Recombinant Human NFE2L3 protein, His-tagged

• Cat.No.: NFE2L3-6744H
• Product Overview: Recombinant Human NFE2L3 protein(), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: LHPKGRELDPAAPPEGQLLREVRALGVPFVPRTSVDAWLVHSVAAGSADEAHGLLGAAAASSTGGAGASVDGGSQAVQGGGGDPRAARSGPLDAGEEEKAPAEPTAQVPDAGGCASEENGVLREKHEAVDHSSQHEENEERVSAQKENSLQQNDDDENKIAEKPDWEAEKTTESRNERHLNGTDT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NFE2L3 nuclear factor (erythroid-derived 2)-like 3 [ Homo sapiens ]
• Official Symbol: NFE2L3
• Synonyms: NFE2L3; nuclear factor (erythroid-derived 2)-like 3; nuclear factor erythroid 2-related factor 3; Nrf3; NFE2-related factor 3; NF-E2-related factor 3; nuclear factor, erythroid derived 2, like 3; nuclear factor-erythroid 2-related factor 3; nuclear factor-erythroid 2 p45-related factor 3; NRF3
• Gene ID: 9603
• mRNA Refseq: NM_004289
• Protein Refseq: NP_004280
• MIM: 604135
• UniProt ID: Q9Y4A8