Recombinant Human NFE4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NFE4-1532H
• Product Overview: NFE4 MS Standard C13 and N15-labeled recombinant protein (NP_001078855) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The erythroid-specific protein encoded by this gene, and the ubiquitous transcription factor CP2, form the stage selector protein (SSP) complex, which is involved in preferential expression of the gamma-globin genes in fetal erythroid cells. Alternate use of an in-frame upstream non-AUG (CUG) translation initiation codon, and a downstream AUG codon, results in two isoforms. While the long isoform (22 kDa) acts as an activator, the short isoform (14 kDa) has been shown to repress gamma-globin gene expression. This gene is located in an intron of the FBXL13 gene on the opposite strand.
• Molecular Mass: 20.33 kDa
• AA Sequence: LDPVPRRSAAAIALPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPRGHAPSAEDPTGSWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NFE4 nuclear factor, erythroid 4 [ Homo sapiens (human) ]
• Official Symbol: NFE4
• Synonyms: NFE4; nuclear factor, erythroid 4; NF-E4; fetal globin activator NF-E4; gamma-globin gene activator; transcription factor NF-E4
• Gene ID: 58160
• mRNA Refseq: NM_001085386
• Protein Refseq: NP_001078855
• MIM: 612133
• UniProt ID: Q86UQ8