Recombinant Human NFE4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NFE4-1532H
Product Overview : NFE4 MS Standard C13 and N15-labeled recombinant protein (NP_001078855) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The erythroid-specific protein encoded by this gene, and the ubiquitous transcription factor CP2, form the stage selector protein (SSP) complex, which is involved in preferential expression of the gamma-globin genes in fetal erythroid cells. Alternate use of an in-frame upstream non-AUG (CUG) translation initiation codon, and a downstream AUG codon, results in two isoforms. While the long isoform (22 kDa) acts as an activator, the short isoform (14 kDa) has been shown to repress gamma-globin gene expression. This gene is located in an intron of the FBXL13 gene on the opposite strand.
Molecular Mass : 20.33 kDa
AA Sequence : LDPVPRRSAAAIALPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPRGHAPSAEDPTGSWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NFE4 nuclear factor, erythroid 4 [ Homo sapiens (human) ]
Official Symbol NFE4
Synonyms NFE4; nuclear factor, erythroid 4; NF-E4; fetal globin activator NF-E4; gamma-globin gene activator; transcription factor NF-E4
Gene ID 58160
mRNA Refseq NM_001085386
Protein Refseq NP_001078855
MIM 612133
UniProt ID Q86UQ8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NFE4 Products

Required fields are marked with *

My Review for All NFE4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon