Recombinant Human NFKB1
Cat.No. : | NFKB1-105H |
Product Overview : | Full-length recombinant human NFkB p50 subunit cDNA (2 - 433aa, derived from BC051765) was constructed with codon optimization with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQI LEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELI RQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLL CDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKP FLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHP GTTKSNAGMKHG |
Purity : | > 90% by SDS-PAGE. |
Applications : | 1. May be used for in vitro human NFkB functional regulations study using NFkB p50 subunit protein mediated intracellular delivery. 2. May be used as specific substrate protein for kinase and ubiquitin related enzyme functional screening assays. 3. May be used as antigen for specific antibody production. |
Storage : | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens (human) ] |
Official Symbol | NFKB1 |
Synonyms | NFKB1; p50; KBF1; p105; EBP-1; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit |
Gene ID | 4790 |
mRNA Refseq | NM_003998 |
Protein Refseq | NP_003989 |
MIM | 164011 |
UniProt ID | P19838 |
Chromosome Location | 4q24 |
Pathway | AGE/RAGE pathway; Activation of NF-kappaB in B Cells; Adaptive Immune System |
Function | double-stranded DNA binding; heat shock protein binding; nucleic acid binding transcription factor activity |
◆ Recombinant Proteins | ||
Nfkb1-4396M | Recombinant Mouse Nfkb1 Protein, Myc/DDK-tagged | +Inquiry |
NFKB1-1846C | Recombinant Chicken NFKB1 protein, His & T7-tagged | +Inquiry |
NFKB1-301H | Recombinant Human NFKB1 protein, His/T7-tagged | +Inquiry |
NFKB1-3973H | Recombinant Human NFKB1 protein, His-tagged | +Inquiry |
NFKB1-120H | Recombinant Human NFKB1 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFKB1-3850HCL | Recombinant Human NFKB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NFKB1 Products
Required fields are marked with *
My Review for All NFKB1 Products
Required fields are marked with *
0
Inquiry Basket