| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Two transcript variants encoding different isoforms have been found for this gene. |
| Form : |
0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : |
MASMTGGQQMGRGHHHHHHGNLYFQGGEFAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQI LEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELI RQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLL CDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKP FLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHP GTTKSNAGMKHG |
| Purity : |
> 90% by SDS-PAGE. |
| Applications : |
1. May be used for in vitro human NFkB functional regulations study using NFkB p50 subunit protein mediated intracellular delivery. 2. May be used as specific substrate protein for kinase and ubiquitin related enzyme functional screening assays. 3. May be used as antigen for specific antibody production. |
| Storage : |
In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |