Recombinant Human NFKB1

Cat.No. : NFKB1-105H
Product Overview : Full-length recombinant human NFkB p50 subunit cDNA (2 - 433aa, derived from BC051765) was constructed with codon optimization with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Two transcript variants encoding different isoforms have been found for this gene.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQI LEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELI RQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLL CDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKP FLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHP GTTKSNAGMKHG
Purity : > 90% by SDS-PAGE.
Applications : 1. May be used for in vitro human NFkB functional regulations study using NFkB p50 subunit protein mediated intracellular delivery. 2. May be used as specific substrate protein for kinase and ubiquitin related enzyme functional screening assays. 3. May be used as antigen for specific antibody production.
Storage : In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens (human) ]
Official Symbol NFKB1
Synonyms NFKB1; p50; KBF1; p105; EBP-1; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit
Gene ID 4790
mRNA Refseq NM_003998
Protein Refseq NP_003989
MIM 164011
UniProt ID P19838
Chromosome Location 4q24
Pathway AGE/RAGE pathway; Activation of NF-kappaB in B Cells; Adaptive Immune System
Function double-stranded DNA binding; heat shock protein binding; nucleic acid binding transcription factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFKB1 Products

Required fields are marked with *

My Review for All NFKB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon