Recombinant Human NFKBIA, His-tagged
Cat.No. : | NFKBIA-28232TH |
Product Overview : | Recombinant full length Human IKB alpha with N terminal His tag; 337 amino acids with tag, Predicted MWt 37.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 317 amino acids |
Description : | This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. |
Conjugation : | HIS |
Molecular Weight : | 37.700kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMFQAAERPQEWAMEGPRDGL KKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQE VPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVK GDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCD PELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSIL KATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEP CNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPY QLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTE SEFTEFTEDELPYDDCVFGGQRLTL |
Sequence Similarities : | Belongs to the NF-kappa-B inhibitor family.Contains 5 ANK repeats. |
Gene Name | NFKBIA nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha [ Homo sapiens ] |
Official Symbol | NFKBIA |
Synonyms | NFKBIA; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha; NFKBI; NF-kappa-B inhibitor alpha; IkappaBalpha; IKBA; MAD 3; |
Gene ID | 4792 |
mRNA Refseq | NM_020529 |
Protein Refseq | NP_065390 |
MIM | 164008 |
Uniprot ID | P25963 |
Chromosome Location | 14q13 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Apoptosis, organism-specific biosystem; |
Function | NF-kappaB binding; NF-kappaB binding; enzyme binding; heat shock protein binding; identical protein binding; |
◆ Recombinant Proteins | ||
NFKBIA-113H | Recombinant Human NFKBIA protein, GST-tagged | +Inquiry |
NFKBIA-1463H | Recombinant Human NFKBIA, GST-tagged | +Inquiry |
NFKBIA-2835R | Recombinant Rhesus Macaque NFKBIA Protein, His (Fc)-Avi-tagged | +Inquiry |
NFKBIA-90H | Recombinant Human IKB-alpha, GST-tagged | +Inquiry |
NFKBIA-28232TH | Recombinant Human NFKBIA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFKBIA-437HCL | Recombinant Human NFKBIA lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFKBIA Products
Required fields are marked with *
My Review for All NFKBIA Products
Required fields are marked with *