Recombinant Human NFU1, His-tagged
| Cat.No. : | NFU1-160H |
| Product Overview : | Recombinant Human NFU1 Iron-Sulfur Cluster Scaffold Homolog Mitochondrial/NFU1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gly10-Pro254) of Human NFU1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 10-254 a.a. |
| Description : | NFU1 Iron-Sulfur Cluster Scaffold Homolog Mitochondrial (NFU1) belongs to the nifU family. NFU1 is widely expressed in many tissues, but expression in adult lung is weak compared to fetal lung. NFU1 interacts with HIRA and EPM2A/laforin which can assemble [4Fe-2S] clusters and deliver them to target proteins. Defects in NFU1 are the cause of multiple mitochondrial dysfunctions syndrome type 1 (MMDS1) which is a severe disorder of systemic energy metabolism, resulting in respiratory failure, lack of neurologic development, weakness, lactic acidosis and early death. |
| AA Sequence : | GAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNP NSLK FIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELD WNLLKPDI YATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIV QLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSPVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | NFU1 NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | NFU1 |
| Synonyms | NFU1; NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae); HIRA interacting protein 5 , HIRIP5; NFU1 iron-sulfur cluster scaffold homolog, mitochondrial; CGI 33; NifU; NIFUC; HIRA-interacting protein 5; iron-sulfur cluster scaffold protein; NifU-like C-terminal domain containing; Nfu; HIRIP; MMDS1; CGI-33; HIRIP5; MGC142252; MGC142254; |
| Gene ID | 27247 |
| mRNA Refseq | NM_001002755 |
| Protein Refseq | NP_001002755 |
| MIM | 608100 |
| UniProt ID | Q9UMS0 |
| Chromosome Location | 2p15-p13 |
| Function | 4 iron, 4 sulfur cluster binding; iron ion binding; protein binding; |
| ◆ Recombinant Proteins | ||
| NFU1-1450C | Recombinant Chicken NFU1 | +Inquiry |
| NFU1-665H | Recombinant Human NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae), His-tagged | +Inquiry |
| NFU1-160H | Recombinant Human NFU1, His-tagged | +Inquiry |
| NFU1-10632M | Recombinant Mouse NFU1 Protein | +Inquiry |
| NFU1-6045M | Recombinant Mouse NFU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFU1-3843HCL | Recombinant Human NFU1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFU1 Products
Required fields are marked with *
My Review for All NFU1 Products
Required fields are marked with *



