Recombinant Human NFYB
Cat.No. : | NFYB-29919TH |
Product Overview : | Recombinant full length Human NFYB with a N terminal proprietary tag; Predicted MWt 48.51 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 207 amino acids |
Description : | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. |
Molecular Weight : | 48.510kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAK DAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDG LSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS |
Sequence Similarities : | Belongs to the NFYB/HAP3 subunit family. |
Gene Name | NFYB nuclear transcription factor Y, beta [ Homo sapiens ] |
Official Symbol | NFYB |
Synonyms | NFYB; nuclear transcription factor Y, beta; nuclear transcription factor Y subunit beta; CBF A; HAP3; NF YB; |
Gene ID | 4801 |
mRNA Refseq | NM_006166 |
Protein Refseq | NP_006157 |
MIM | 189904 |
Uniprot ID | P25208 |
Chromosome Location | 12q22-q23 |
Pathway | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; |
Function | DNA binding; protein binding; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
NFYB-224H | Recombinant Human NFYB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NFYB-2839R | Recombinant Rhesus Macaque NFYB Protein, His (Fc)-Avi-tagged | +Inquiry |
NFYB-3020R | Recombinant Rhesus monkey NFYB Protein, His-tagged | +Inquiry |
Nfyb-4402M | Recombinant Mouse Nfyb Protein, Myc/DDK-tagged | +Inquiry |
NFYB-338HF | Recombinant Full Length Human NFYB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFYB-3839HCL | Recombinant Human NFYB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFYB Products
Required fields are marked with *
My Review for All NFYB Products
Required fields are marked with *
0
Inquiry Basket