Recombinant Human NFYB

Cat.No. : NFYB-29919TH
Product Overview : Recombinant full length Human NFYB with a N terminal proprietary tag; Predicted MWt 48.51 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 207 amino acids
Description : The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants.
Molecular Weight : 48.510kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMN DHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAK DAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILF AMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDG LSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG VQQIQFS
Sequence Similarities : Belongs to the NFYB/HAP3 subunit family.
Gene Name NFYB nuclear transcription factor Y, beta [ Homo sapiens ]
Official Symbol NFYB
Synonyms NFYB; nuclear transcription factor Y, beta; nuclear transcription factor Y subunit beta; CBF A; HAP3; NF YB;
Gene ID 4801
mRNA Refseq NM_006166
Protein Refseq NP_006157
MIM 189904
Uniprot ID P25208
Chromosome Location 12q22-q23
Pathway Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Diabetes pathways, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem;
Function DNA binding; protein binding; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFYB Products

Required fields are marked with *

My Review for All NFYB Products

Required fields are marked with *

0
cart-icon
0
compare icon