Recombinant Human NGB Protein, GST-tagged

Cat.No. : NGB-1025H
Product Overview : Recombinant Human NGB Protein (1 - 151 aa) was expressed in E. coli with GST tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-151 a.a.
Description : This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions.
Form : Lyophilized Powder
AA sequence : MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Purity : 95% by SDS-PAGE
Storage buffer : Sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.)
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage
Gene Name NGB neuroglobin [ Homo sapiens ]
Official Symbol NGB
Synonyms neuroglobin
Gene ID 58157
mRNA Refseq NM_021257
Protein Refseq NP_067080
MIM 605304
UniProt ID Q9NPG2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NGB Products

Required fields are marked with *

My Review for All NGB Products

Required fields are marked with *

0
cart-icon