Recombinant Human NGB Protein, GST-tagged
Cat.No. : | NGB-1025H |
Product Overview : | Recombinant Human NGB Protein (1 - 151 aa) was expressed in E. coli with GST tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-151 a.a. |
Description : | This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing oxygen availability and providing protection under hypoxic/ischemic conditions. |
Form : | Lyophilized Powder |
AA sequence : | MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE |
Purity : | 95% by SDS-PAGE |
Storage buffer : | Sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.) |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
Gene Name | NGB neuroglobin [ Homo sapiens ] |
Official Symbol | NGB |
Synonyms | neuroglobin |
Gene ID | 58157 |
mRNA Refseq | NM_021257 |
Protein Refseq | NP_067080 |
MIM | 605304 |
UniProt ID | Q9NPG2 |
◆ Recombinant Proteins | ||
NGB-1025H | Recombinant Human NGB Protein, GST-tagged | +Inquiry |
NGB-2840R | Recombinant Rhesus Macaque NGB Protein, His (Fc)-Avi-tagged | +Inquiry |
NGB-1854H | Recombinant Human NGB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NGB-3639R | Recombinant Rat NGB Protein, His (Fc)-Avi-tagged | +Inquiry |
NGB-2649H | Recombinant Human NGB protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGB-3837HCL | Recombinant Human NGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGB Products
Required fields are marked with *
My Review for All NGB Products
Required fields are marked with *
0
Inquiry Basket