Recombinant Human NGF protein, His&Myc-tagged
Cat.No. : | NGF-6444H |
Product Overview : | Recombinant Human NGF protein(P01138)(122-241aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 122-241aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
Gene Name | NGF nerve growth factor (beta polypeptide) [ Homo sapiens ] |
Official Symbol | NGF |
Synonyms | NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428; |
Gene ID | 4803 |
mRNA Refseq | NM_002506 |
Protein Refseq | NP_002497 |
MIM | 162030 |
UniProt ID | P01138 |
◆ Recombinant Proteins | ||
NGF-003H | Active Recombinant Human NGF, HIgG1 Fc-tagged | +Inquiry |
NGF-1157C | Recombinant Cattle NGF Protein, His-tagged | +Inquiry |
NGF-1869H | Recombinant Human Nerve Growth Factor (beta polypeptide) | +Inquiry |
NGF-145H | Recombinant Human NGF Protein | +Inquiry |
NGF-213H | Active Recombinant Human beta-NGF Protein | +Inquiry |
◆ Native Proteins | ||
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGF Products
Required fields are marked with *
My Review for All NGF Products
Required fields are marked with *