Recombinant Human NHLRC1 Protein, GST-tagged
Cat.No. : | NHLRC1-30H |
Product Overview : | Human NHLRC1 partial ORF ( NP_940988.2, 137 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a single subunit E3 ubiquitin ligase. Laforin is polyubiquitinated by the encoded protein. Defects in this intronless gene lead to an accumulation of laforin and onset of Lafora disease, also known as progressive myoclonic epilepsy type 2 (EPM2). |
Molecular Mass : | 37.84 kDa |
AA Sequence : | KTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDVTITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLHLLDVDF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NHLRC1 NHL repeat containing E3 ubiquitin protein ligase 1 [ Homo sapiens (human) ] |
Official Symbol | NHLRC1 |
Synonyms | NHLRC1; NHL repeat containing E3 ubiquitin protein ligase 1; EPM2A; EPM2B; MALIN; bA204B7.2; E3 ubiquitin-protein ligase NHLRC1; NHL repeat containing 1; NHL repeat-containing protein 1; RING-type E3 ubiquitin transferase NHLRC1; EC 2.3.2.27 |
Gene ID | 378884 |
mRNA Refseq | NM_198586 |
Protein Refseq | NP_940988 |
MIM | 608072 |
UniProt ID | Q6VVB1 |
◆ Recombinant Proteins | ||
NHLRC1-1291H | Recombinant Human NHLRC1, GST-tagged | +Inquiry |
NHLRC1-3643R | Recombinant Rat NHLRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NHLRC1-3984R | Recombinant Rat NHLRC1 Protein | +Inquiry |
NHLRC1-30H | Recombinant Human NHLRC1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NHLRC1 Products
Required fields are marked with *
My Review for All NHLRC1 Products
Required fields are marked with *
0
Inquiry Basket