Recombinant Human NHP2 Protein, GST-tagged
Cat.No. : | NHP2-5979H |
Product Overview : | Human NOLA2 full-length ORF ( NP_060308.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nhp2p. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
Molecular Mass : | 43.6 kDa |
AA Sequence : | MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NHP2 NHP2 ribonucleoprotein homolog (yeast) [ Homo sapiens ] |
Official Symbol | NHP2 |
Synonyms | NHP2; NHP2 ribonucleoprotein homolog (yeast); NOLA2, nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); H/ACA ribonucleoprotein complex subunit 2; FLJ20479; NHP2-like protein; snoRNP protein NHP2; nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); DKCB2; NHP2P; NOLA2; |
Gene ID | 55651 |
mRNA Refseq | NM_001034833 |
Protein Refseq | NP_001030005 |
MIM | 606470 |
UniProt ID | Q9NX24 |
◆ Recombinant Proteins | ||
NHP2-4552C | Recombinant Chicken NHP2 | +Inquiry |
NHP2-5979H | Recombinant Human NHP2 Protein, GST-tagged | +Inquiry |
NHP2-2845R | Recombinant Rhesus Macaque NHP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NHP2-3399H | Recombinant Human NHP2 Ribonucleoprotein Homolog (Yeast), His-tagged | +Inquiry |
NHP2-6701HF | Recombinant Full Length Human NHP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NHP2-3831HCL | Recombinant Human NHP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NHP2 Products
Required fields are marked with *
My Review for All NHP2 Products
Required fields are marked with *