Recombinant Human NHP2 protein, His-tagged
| Cat.No. : | NHP2-4978H |
| Product Overview : | Recombinant Human NHP2 protein(1-153 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-153 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NHP2 NHP2 ribonucleoprotein homolog (yeast) [ Homo sapiens ] |
| Official Symbol | NHP2 |
| Synonyms | NHP2; NHP2 ribonucleoprotein homolog (yeast); NOLA2, nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); H/ACA ribonucleoprotein complex subunit 2; FLJ20479; NHP2-like protein; snoRNP protein NHP2; nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); DKCB2; NHP2P; NOLA2; |
| Gene ID | 55651 |
| mRNA Refseq | NM_001034833 |
| Protein Refseq | NP_001030005 |
| MIM | 606470 |
| UniProt ID | Q9NX24 |
| ◆ Recombinant Proteins | ||
| NHP2-4978H | Recombinant Human NHP2 protein, His-tagged | +Inquiry |
| NHP2-11876Z | Recombinant Zebrafish NHP2 | +Inquiry |
| NHP2-3026R | Recombinant Rhesus monkey NHP2 Protein, His-tagged | +Inquiry |
| NHP2-1292H | Recombinant Human NHP2, His-tagged | +Inquiry |
| NHP2-2845R | Recombinant Rhesus Macaque NHP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NHP2-3831HCL | Recombinant Human NHP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NHP2 Products
Required fields are marked with *
My Review for All NHP2 Products
Required fields are marked with *
