Recombinant Human NHP2 protein, His-tagged

• Cat.No.: NHP2-4978H
• Product Overview: Recombinant Human NHP2 protein(1-153 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-153 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NHP2 NHP2 ribonucleoprotein homolog (yeast) [ Homo sapiens ]
• Official Symbol: NHP2
• Synonyms: NHP2; NHP2 ribonucleoprotein homolog (yeast); NOLA2, nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); H/ACA ribonucleoprotein complex subunit 2; FLJ20479; NHP2-like protein; snoRNP protein NHP2; nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); DKCB2; NHP2P; NOLA2
• Gene ID: 55651
• mRNA Refseq: NM_001034833
• Protein Refseq: NP_001030005
• MIM: 606470
• UniProt ID: Q9NX24