Recombinant Human NID1 protein, GST-tagged
| Cat.No. : | NID1-186H |
| Product Overview : | Recombinant Human NID1(1148 a.a. - 1247 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1148-1247 a.a. |
| Description : | This gene encodes a member of the nidogen family of basement membrane glycoproteins. The protein interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHL CLATPGSRTCRCPDNTLGVDCIERK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | NID1 nidogen 1 [ Homo sapiens ] |
| Official Symbol | NID1 |
| Synonyms | NID1; nidogen 1; NID, nidogen (enactin); nidogen-1; entactin; NID-1; enactin; NID; |
| Gene ID | 4811 |
| mRNA Refseq | NM_002508 |
| Protein Refseq | NP_002499 |
| MIM | 131390 |
| UniProt ID | P14543 |
| Chromosome Location | 1q43 |
| Function | calcium ion binding; collagen binding; extracellular matrix binding; laminin-1 binding; |
| ◆ Recombinant Proteins | ||
| NID1-186H | Recombinant Human NID1 protein, GST-tagged | +Inquiry |
| NID1-10661M | Recombinant Mouse NID1 Protein | +Inquiry |
| NID1-685M | Recombinant Mouse NID1 Protein (428-665 aa), His-tagged | +Inquiry |
| NID1-331H | Active Recombinant Human NID1 protein, His-tagged | +Inquiry |
| NID1-3622H | Recombinant Human NID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NID1-3829HCL | Recombinant Human NID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NID1 Products
Required fields are marked with *
My Review for All NID1 Products
Required fields are marked with *
