Recombinant Human NID1 protein, GST-tagged

Cat.No. : NID1-186H
Product Overview : Recombinant Human NID1(1148 a.a. - 1247 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1148-1247 a.a.
Description : This gene encodes a member of the nidogen family of basement membrane glycoproteins. The protein interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHL CLATPGSRTCRCPDNTLGVDCIERK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name NID1 nidogen 1 [ Homo sapiens ]
Official Symbol NID1
Synonyms NID1; nidogen 1; NID, nidogen (enactin); nidogen-1; entactin; NID-1; enactin; NID;
Gene ID 4811
mRNA Refseq NM_002508
Protein Refseq NP_002499
MIM 131390
UniProt ID P14543
Chromosome Location 1q43
Function calcium ion binding; collagen binding; extracellular matrix binding; laminin-1 binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NID1 Products

Required fields are marked with *

My Review for All NID1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon