"NID1" Related Products

Expand
Expand

Recombinant Human NID1 protein, GST-tagged

Cat.No.: NID1-186H
Product Overview: Recombinant Human NID1(1148 a.a. - 1247 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a member of the nidogen family of basement membrane glycoproteins. The protein interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHL CLATPGSRTCRCPDNTLGVDCIERK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: NID1 nidogen 1 [ Homo sapiens ]
Official Symbol: NID1
Synonyms: NID1; nidogen 1; NID, nidogen (enactin); nidogen-1; entactin; NID-1; enactin; NID;
Gene ID: 4811
mRNA Refseq: NM_002508
Protein Refseq: NP_002499
MIM: 131390
UniProt ID: P14543
Chromosome Location: 1q43
Function: calcium ion binding; collagen binding; extracellular matrix binding; laminin-1 binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.