Recombinant Human NID1 protein, GST-tagged
Cat.No. : | NID1-186H |
Product Overview : | Recombinant Human NID1(1148 a.a. - 1247 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1148-1247 a.a. |
Description : | This gene encodes a member of the nidogen family of basement membrane glycoproteins. The protein interacts with several other components of basement membranes, and may play a role in cell interactions with the extracellular matrix. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYGITTALSQCPQGHNYCSVNNGGCTHL CLATPGSRTCRCPDNTLGVDCIERK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NID1 nidogen 1 [ Homo sapiens ] |
Official Symbol | NID1 |
Synonyms | NID1; nidogen 1; NID, nidogen (enactin); nidogen-1; entactin; NID-1; enactin; NID; |
Gene ID | 4811 |
mRNA Refseq | NM_002508 |
Protein Refseq | NP_002499 |
MIM | 131390 |
UniProt ID | P14543 |
Chromosome Location | 1q43 |
Function | calcium ion binding; collagen binding; extracellular matrix binding; laminin-1 binding; |
◆ Recombinant Proteins | ||
NID1-10661M | Recombinant Mouse NID1 Protein | +Inquiry |
NID1-186H | Recombinant Human NID1 protein, GST-tagged | +Inquiry |
NID1-3067H | Recombinant Human NID1 protein, His-tagged | +Inquiry |
NID1-331H | Active Recombinant Human NID1 protein, His-tagged | +Inquiry |
NID1-1904HFL | Recombinant Full Length Human NID1 protein, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NID1-3829HCL | Recombinant Human NID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NID1 Products
Required fields are marked with *
My Review for All NID1 Products
Required fields are marked with *