Recombinant Human NIPAL4 Protein

Cat.No. : NIPAL4-5871H
Product Overview : Human NIPAL4 full-length ORF (AAI60182.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene likely encodes a membrane receptor. Mutations in this gene have been associated with autosomal recessive congenital ichthyosis. [provided by RefSeq, Feb 2010]
Form : Liquid
Molecular Mass : 51.3 kDa
AA Sequence : MPGDSSPGTLPLWDASLSPPLGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAPGPMELRVSNTSCENGSLLHLYCSSQEVLCQIVNDLSPEVPSNATFHSWQERIRQNYGFYIGLGLAFLSSFLIGSSVILKKKGLLRLVATGATRAVDGGFGYLKDAMWWAGFLTMAAGEVANFGAYAFAPATVVTPLGALSVLISAILSSYFLRESLNLLGKLGCVICVAGSTVMVIHAPEEEKVTTIMEMASKMKDTGFIVFAVLLLVSCLILIFVIAPRYGQRNILIYIIICSVIGAFSVAAVKGLGITIKNFFQGLPVVRHPLPYILSLILALSLSTQVNFLNRALDIFNTSLVFPIYYVFFTTVVVTSSIILFKEWYSMSAVDIAGTLSGFVTIILGVFMLHAFKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name NIPAL4 NIPA-like domain containing 4 [ Homo sapiens ]
Official Symbol NIPAL4
Synonyms NIPAL4; NIPA-like domain containing 4; NIPA like 4; magnesium transporter NIPA4; ichthyin; ICHYN; NIPA-like protein 4; non-imprinted in Prader-Willi/Angelman syndrome region protein 4; ICHTHYIN;
Gene ID 348938
mRNA Refseq NM_001099287
Protein Refseq NP_001092757
MIM 609383
UniProt ID Q0D2K0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NIPAL4 Products

Required fields are marked with *

My Review for All NIPAL4 Products

Required fields are marked with *

0
cart-icon
0
compare icon