Recombinant Human NIPAL4 Protein
Cat.No. : | NIPAL4-5871H |
Product Overview : | Human NIPAL4 full-length ORF (AAI60182.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene likely encodes a membrane receptor. Mutations in this gene have been associated with autosomal recessive congenital ichthyosis. [provided by RefSeq, Feb 2010] |
Form : | Liquid |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MPGDSSPGTLPLWDASLSPPLGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAPGPMELRVSNTSCENGSLLHLYCSSQEVLCQIVNDLSPEVPSNATFHSWQERIRQNYGFYIGLGLAFLSSFLIGSSVILKKKGLLRLVATGATRAVDGGFGYLKDAMWWAGFLTMAAGEVANFGAYAFAPATVVTPLGALSVLISAILSSYFLRESLNLLGKLGCVICVAGSTVMVIHAPEEEKVTTIMEMASKMKDTGFIVFAVLLLVSCLILIFVIAPRYGQRNILIYIIICSVIGAFSVAAVKGLGITIKNFFQGLPVVRHPLPYILSLILALSLSTQVNFLNRALDIFNTSLVFPIYYVFFTTVVVTSSIILFKEWYSMSAVDIAGTLSGFVTIILGVFMLHAFKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS |
Applications : | Antibody Production Functional Study Compound Screening |
Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | NIPAL4 NIPA-like domain containing 4 [ Homo sapiens ] |
Official Symbol | NIPAL4 |
Synonyms | NIPAL4; NIPA-like domain containing 4; NIPA like 4; magnesium transporter NIPA4; ichthyin; ICHYN; NIPA-like protein 4; non-imprinted in Prader-Willi/Angelman syndrome region protein 4; ICHTHYIN; |
Gene ID | 348938 |
mRNA Refseq | NM_001099287 |
Protein Refseq | NP_001092757 |
MIM | 609383 |
UniProt ID | Q0D2K0 |
◆ Recombinant Proteins | ||
NIPAL4-6632HF | Recombinant Full Length Human NIPAL4 Protein | +Inquiry |
NIPAL4-773Z | Recombinant Zebrafish NIPAL4 | +Inquiry |
NIPAL4-10675M | Recombinant Mouse NIPAL4 Protein | +Inquiry |
NIPAL4-6072M | Recombinant Mouse NIPAL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIPAL4-5871H | Recombinant Human NIPAL4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIPAL4 Products
Required fields are marked with *
My Review for All NIPAL4 Products
Required fields are marked with *
0
Inquiry Basket