Recombinant Human NKAPL protein, GST-tagged
Cat.No. : | NKAPL-301398H |
Product Overview : | Recombinant Human NKAPL (201-275 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Tyr201-Met275 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | YSDSDSNSESDTNSDSDDDKKRVKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | NKAPL NFKB activating protein-like [ Homo sapiens ] |
Official Symbol | NKAPL |
Synonyms | NKAPL; NFKB activating protein-like; C6orf194, chromosome 6 open reading frame 194; NKAP-like protein; bA424I5.1; C6orf194; MGC126730; MGC126734; |
Gene ID | 222698 |
mRNA Refseq | NM_001007531 |
Protein Refseq | NP_001007532 |
UniProt ID | Q5M9Q1 |
◆ Recombinant Proteins | ||
NKAPL-5887H | Recombinant Human NKAPL Protein, GST-tagged | +Inquiry |
NKAPL-6661HF | Recombinant Full Length Human NKAPL Protein, GST-tagged | +Inquiry |
NKAPL-301398H | Recombinant Human NKAPL protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKAPL-438HCL | Recombinant Human NKAPL lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKAPL Products
Required fields are marked with *
My Review for All NKAPL Products
Required fields are marked with *