Recombinant Human NKAPL protein, GST-tagged

• Cat.No.: NKAPL-301398H
• Product Overview: Recombinant Human NKAPL protein(201-275 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 201-275 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: YSDSDSNSESDTNSDSDDDKKRVKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTM
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NKAPL NFKB activating protein-like [ Homo sapiens ]
• Official Symbol: NKAPL
• Synonyms: NKAPL; NFKB activating protein-like; C6orf194, chromosome 6 open reading frame 194; NKAP-like protein; bA424I5.1; C6orf194; MGC126730; MGC126734
• Gene ID: 222698
• mRNA Refseq: NM_001007531
• Protein Refseq: NP_001007532
• UniProt ID: Q5M9Q1