Recombinant Human NKAPL protein, GST-tagged

• Cat.No.: NKAPL-301398H
• Product Overview: Recombinant Human NKAPL (201-275 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Tyr201-Met275
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: YSDSDSNSESDTNSDSDDDKKRVKAKKKKKKKKHKTKKKKNKKTKKESSDSSCKDSEEDLSEATWMEQPNVADTM
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: NKAPL NFKB activating protein-like [ Homo sapiens ]
• Official Symbol: NKAPL
• Synonyms: NKAPL; NFKB activating protein-like; C6orf194, chromosome 6 open reading frame 194; NKAP-like protein; bA424I5.1; C6orf194; MGC126730; MGC126734
• Gene ID: 222698
• mRNA Refseq: NM_001007531
• Protein Refseq: NP_001007532
• UniProt ID: Q5M9Q1