Recombinant Human NKIRAS1 protein, GST-tagged
Cat.No. : | NKIRAS1-1301H |
Product Overview : | Recombinant Human NKIRAS1 protein(1-192 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-192 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | NKIRAS1 NFKB inhibitor interacting Ras-like 1 [ Homo sapiens ] |
Official Symbol | NKIRAS1 |
Synonyms | NKIRAS1; NFKB inhibitor interacting Ras-like 1; NFKB inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; kappaB Ras1; KBRAS1; kappa B-ras 1; kappa B-Ras protein 1; I-kappa-B-interacting Ras-like protein 1; NFKB inhibitor interacting Ras-like protein 1; kappaB-Ras1; |
Gene ID | 28512 |
mRNA Refseq | NM_020345 |
Protein Refseq | NP_065078 |
MIM | 604496 |
UniProt ID | Q9NYS0 |
◆ Recombinant Proteins | ||
NKIRAS1-4056H | Recombinant Human NKIRAS1 protein, His-tagged | +Inquiry |
NKIRAS1-5889H | Recombinant Human NKIRAS1 Protein, His-tagged | +Inquiry |
NKIRAS1-3034R | Recombinant Rhesus monkey NKIRAS1 Protein, His-tagged | +Inquiry |
NKIRAS1-492C | Recombinant Cynomolgus Monkey NKIRAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKIRAS1-1301H | Recombinant Human NKIRAS1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKIRAS1-3818HCL | Recombinant Human NKIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKIRAS1 Products
Required fields are marked with *
My Review for All NKIRAS1 Products
Required fields are marked with *