Recombinant Human NKIRAS1 Protein, His-tagged

Cat.No. : NKIRAS1-5889H
Product Overview : Human NKIRAS1 (NP_065078, 1 a.a. - 192 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : NKIRAS1 (NFKB Inhibitor Interacting Ras Like 1) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS2.
Form : Liquid
Molecular Mass : 23.8 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT).
Gene Name NKIRAS1 NFKB inhibitor interacting Ras-like 1 [ Homo sapiens ]
Official Symbol NKIRAS1
Synonyms NKIRAS1; NFKB inhibitor interacting Ras-like 1; NFKB inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; kappaB Ras1; KBRAS1; kappa B-ras 1; kappa B-Ras protein 1; I-kappa-B-interacting Ras-like protein 1; NFKB inhibitor interacting Ras-like protein 1; kappaB-Ras1;
Gene ID 28512
mRNA Refseq NM_020345
Protein Refseq NP_065078
MIM 604496
UniProt ID Q9NYS0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKIRAS1 Products

Required fields are marked with *

My Review for All NKIRAS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon