Recombinant Human NKIRAS1 Protein, His-tagged

• Cat.No.: NKIRAS1-5889H
• Product Overview: Human NKIRAS1 (NP_065078, 1 a.a. - 192 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: NKIRAS1 (NFKB Inhibitor Interacting Ras Like 1) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS2.
• Form: Liquid
• Molecular Mass: 23.8 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT).

Gene Information

• Gene Name: NKIRAS1 NFKB inhibitor interacting Ras-like 1 [ Homo sapiens ]
• Official Symbol: NKIRAS1
• Synonyms: NKIRAS1; NFKB inhibitor interacting Ras-like 1; NFKB inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; kappaB Ras1; KBRAS1; kappa B-ras 1; kappa B-Ras protein 1; I-kappa-B-interacting Ras-like protein 1; NFKB inhibitor interacting Ras-like protein 1; kappaB-Ras1
• Gene ID: 28512
• mRNA Refseq: NM_020345
• Protein Refseq: NP_065078
• MIM: 604496
• UniProt ID: Q9NYS0