Recombinant Human NKIRAS1 Protein, His-tagged
Cat.No. : | NKIRAS1-5889H |
Product Overview : | Human NKIRAS1 (NP_065078, 1 a.a. - 192 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | NKIRAS1 (NFKB Inhibitor Interacting Ras Like 1) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS2. |
Form : | Liquid |
Molecular Mass : | 23.8 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT). |
Gene Name | NKIRAS1 NFKB inhibitor interacting Ras-like 1 [ Homo sapiens ] |
Official Symbol | NKIRAS1 |
Synonyms | NKIRAS1; NFKB inhibitor interacting Ras-like 1; NFKB inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; kappaB Ras1; KBRAS1; kappa B-ras 1; kappa B-Ras protein 1; I-kappa-B-interacting Ras-like protein 1; NFKB inhibitor interacting Ras-like protein 1; kappaB-Ras1; |
Gene ID | 28512 |
mRNA Refseq | NM_020345 |
Protein Refseq | NP_065078 |
MIM | 604496 |
UniProt ID | Q9NYS0 |
◆ Recombinant Proteins | ||
NKIRAS1-4056H | Recombinant Human NKIRAS1 protein, His-tagged | +Inquiry |
NKIRAS1-3034R | Recombinant Rhesus monkey NKIRAS1 Protein, His-tagged | +Inquiry |
NKIRAS1-5545H | Recombinant Human NFKB Inhibitor Interacting Ras-like 1, His-tagged | +Inquiry |
NKIRAS1-492C | Recombinant Cynomolgus Monkey NKIRAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKIRAS1-5889H | Recombinant Human NKIRAS1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKIRAS1-3818HCL | Recombinant Human NKIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKIRAS1 Products
Required fields are marked with *
My Review for All NKIRAS1 Products
Required fields are marked with *
0
Inquiry Basket