Recombinant Human NKIRAS2, His-tagged
Cat.No. : | NKIRAS2-27758TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 52-191 of Human NKIRAS2 with N terminal His tag; Predicted MWt 17 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 52-191 a.a. |
Description : | NKIRAS2 (NF-kappa-B inhibitor-interacting Ras-like protein 2) is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity. It interacts with the PEST domain of NF-kappa-B inhibitor beta (NFKBIB) decreasing the rate of degradation. It may act by blocking phosphorylation of NFKBIB. There are two different isoforms. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSR ESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRR VDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASK MTQPQSKSAFPLSRKNKGSGSLDG |
Gene Name | NKIRAS2 NFKB inhibitor interacting Ras-like 2 [ Homo sapiens ] |
Official Symbol | NKIRAS2 |
Synonyms | NKIRAS2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras like protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; DKFZP434N1526; kappaB Ras2; KBRAS2; |
Gene ID | 28511 |
mRNA Refseq | NM_001001349 |
Protein Refseq | NP_001001349 |
MIM | 604497 |
Uniprot ID | Q9NYR9 |
Chromosome Location | 17q21.31 |
Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | GTP binding; GTPase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
NKIRAS2-15859H | Recombinant Human NKIRAS2, His-tagged | +Inquiry |
NKIRAS2-884Z | Recombinant Zebrafish NKIRAS2 | +Inquiry |
NKIRAS2-2854R | Recombinant Rhesus Macaque NKIRAS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKIRAS2-5596H | Recombinant Human NFKB Inhibitor Interacting Ras-Like 2, His-tagged | +Inquiry |
NKIRAS2-5891H | Recombinant Human NKIRAS2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKIRAS2-3817HCL | Recombinant Human NKIRAS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKIRAS2 Products
Required fields are marked with *
My Review for All NKIRAS2 Products
Required fields are marked with *