Recombinant Human NKX2-3 Protein, GST-tagged
Cat.No. : | NKX2-3-5898H |
Product Overview : | Human NKX2-3 full-length ORF ( NP_660328.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-293 a.a. |
Description : | NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM |
Molecular Mass : | 58.9 kDa |
AA Sequence : | MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAGPPRRPLPCSPPAARPEAAPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKX2-3 NK2 homeobox 3 [ Homo sapiens ] |
Official Symbol | NKX2-3 |
Synonyms | NKX2-3; NK2 homeobox 3; NK 2 (Drosophila) homolog C , NK2 transcription factor related, locus 3 (Drosophila) , NKX2C; homeobox protein Nkx-2.3; CSX3; NKX2.3; NKX4 3; homeobox protein NK-2 homolog C; NK2 transcription factor related, locus 3; NK2.3; NKX2C; NKX4-3; |
Gene ID | 159296 |
mRNA Refseq | NM_145285 |
Protein Refseq | NP_660328 |
MIM | 606727 |
UniProt ID | Q8TAU0 |
◆ Recombinant Proteins | ||
NKX2-3-5898H | Recombinant Human NKX2-3 Protein, GST-tagged | +Inquiry |
NKX2-3-10699M | Recombinant Mouse NKX2-3 Protein | +Inquiry |
NKX2-3-6678HF | Recombinant Full Length Human NKX2-3 Protein, GST-tagged | +Inquiry |
NKX2-3-301372H | Recombinant Human NKX2-3 protein, GST-tagged | +Inquiry |
NKX2-3-6588C | Recombinant Chicken NKX2-3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-3 Products
Required fields are marked with *
My Review for All NKX2-3 Products
Required fields are marked with *