Recombinant Human NKX2-5 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : NKX2-5-340H
Product Overview : NKX2 MS Standard C13 and N15-labeled recombinant protein (NP_004378) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Molecular Mass : 34.9 kDa
AA Sequence : MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NKX2-5 NK2 homeobox 5 [ Homo sapiens (human) ]
Official Symbol NKX2-5
Synonyms NKX2-5; NK2 homeobox 5; cardiac specific homeo box, CSX, NK2 transcription factor related, locus 5 (Drosophila), NKX2E; homeobox protein Nkx-2.5; CSX1; NKX2.5; NKX4 1; tinman paralog (Drosophila); tinman paralog; homeobox protein CSX; cardiac-specific homeobox 1; homeobox protein NK-2 homolog E; NK2 transcription factor related, locus 5; CSX; VSD3; CHNG5; HLHS2; NKX2E; NKX4-1; FLJ52202; FLJ97166; FLJ97195; FLJ97197; FLJ99536;
Gene ID 1482
mRNA Refseq NM_004387
Protein Refseq NP_004378
MIM 600584
UniProt ID P52952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX2-5 Products

Required fields are marked with *

My Review for All NKX2-5 Products

Required fields are marked with *

0
cart-icon
0
compare icon