Recombinant Human NKX2-6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NKX2-6-3578H |
Product Overview : | NKX2 MS Standard C13 and N15-labeled recombinant protein (NP_001129743) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a homeobox-containing protein that belongs to the NK-2 homeobox family. This protein is a vertebrate homolog of Drosophila homeobox-containing protein called 'tinman', which has been shown to be essential for development of the heart-like dorsal vessel. In conjunction with related gene, NKX2-5, this gene may play a role in both pharyngeal and cardiac embryonic development. Mutations in this gene are associated with persistent truncus arteriosus. |
Molecular Mass : | 23.1 kDa |
AA Sequence : | MDAERMGEPQPGLNAASPLGGGTRVPERGVGNSGDSVRGGRSEQPKARQRRKPRVLFSQAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIWFQNRRYKCKRQRQDKSLELAGHPLTPRRVAVPVLVRDGKPCLGPGPGAPAFPSPYSAAVSPYSCYGGYSGAPYGAGYGTCYAGAPSGPAPHTPLASAGFGHGGQNATPQGHLAATLQGVRAWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NKX2-6 NK2 homeobox 6 [ Homo sapiens (human) ] |
Official Symbol | NKX2-6 |
Synonyms | NKX2-6; NK2 homeobox 6; NK2 transcription factor related, locus 6 (Drosophila); homeobox protein Nkx-2.6; CSX2; NKX4 2; tinman paralog (Drosophila); tinman paralog; homeobox protein NKX2.6; homeobox protein NK2 homolog F; NK2 transcription factor related, locus 6; NKX2F; NKX4-2; |
Gene ID | 137814 |
mRNA Refseq | NM_001136271 |
Protein Refseq | NP_001129743 |
MIM | 611770 |
UniProt ID | A6NCS4 |
◆ Recombinant Proteins | ||
NKX2-6-6086M | Recombinant Mouse NKX2-6 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKX2-6-10701M | Recombinant Mouse NKX2-6 Protein | +Inquiry |
NKX2-6-3578H | Recombinant Human NKX2-6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Nkx2-6-4425M | Recombinant Mouse Nkx2-6 Protein, Myc/DDK-tagged | +Inquiry |
NKX2-6-6694C | Recombinant Chicken NKX2-6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-6 Products
Required fields are marked with *
My Review for All NKX2-6 Products
Required fields are marked with *