Recombinant Human NKX2-8 protein, His-tagged
Cat.No. : | NKX2-8-2497H |
Product Overview : | Recombinant Human NKX2-8 protein(1-160 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-160 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NKX2-8 NK2 homeobox 8 [ Homo sapiens ] |
Official Symbol | NKX2-8 |
Synonyms | NKX2-8; NK2 homeobox 8; NK 2 homolog H (Drosophila) , NK2 transcription factor related, locus 8 (Drosophila) , NKX2H; homeobox protein Nkx-2.8; Nkx2 9; NKX2.8; NK-2 homolog 8; NK-2 homolog H; homeobox protein NK-2 homolog H; NK2 transcription factor related, locus 8; NKX2H; Nkx2-9; |
Gene ID | 26257 |
mRNA Refseq | NM_014360 |
Protein Refseq | NP_055175 |
MIM | 603245 |
UniProt ID | O15522 |
◆ Recombinant Proteins | ||
NKX2-8-5901H | Recombinant Human NKX2-8 Protein, GST-tagged | +Inquiry |
NKX2-8-1304H | Recombinant Human NKX2-8, GST-tagged | +Inquiry |
NKX2-8-6704HF | Recombinant Full Length Human NKX2-8 Protein, GST-tagged | +Inquiry |
NKX2-8-2497H | Recombinant Human NKX2-8 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKX2-8-1199HCL | Recombinant Human NKX2-8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-8 Products
Required fields are marked with *
My Review for All NKX2-8 Products
Required fields are marked with *