Recombinant Human NKX2-8 protein, His-tagged

• Cat.No.: NKX2-8-2497H
• Product Overview: Recombinant Human NKX2-8 protein(1-160 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-160 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NKX2-8 NK2 homeobox 8 [ Homo sapiens ]
• Official Symbol: NKX2-8
• Synonyms: NKX2-8; NK2 homeobox 8; NK 2 homolog H (Drosophila) , NK2 transcription factor related, locus 8 (Drosophila) , NKX2H; homeobox protein Nkx-2.8; Nkx2 9; NKX2.8; NK-2 homolog 8; NK-2 homolog H; homeobox protein NK-2 homolog H; NK2 transcription factor related, locus 8; NKX2H; Nkx2-9
• Gene ID: 26257
• mRNA Refseq: NM_014360
• Protein Refseq: NP_055175
• MIM: 603245
• UniProt ID: O15522