Recombinant Human NKX3-1
Cat.No. : | NKX3-1-28096TH |
Product Overview : | Recombinant fragment of Human Nkx3.1 with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Highly expressed in the prostate and, at a lower level, in the testis. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIEL ERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT KRKQLSSELGDLEKHSSLPALKEEAFSRAS |
Sequence Similarities : | Belongs to the NK-3 homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name | NKX3-1 NK3 homeobox 1 [ Homo sapiens ] |
Official Symbol | NKX3-1 |
Synonyms | NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1; |
Gene ID | 4824 |
mRNA Refseq | NM_006167 |
Protein Refseq | NP_006158 |
MIM | 602041 |
Uniprot ID | Q99801 |
Chromosome Location | 8p21.2 |
Pathway | Coregulation of Androgen receptor activity, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem; |
Function | androgen receptor activity; core promoter binding; contributes_to cysteine-type endopeptidase activator activity involved in apoptotic process; estrogen receptor activity; estrogen receptor binding; |
◆ Recombinant Proteins | ||
NKX3-1-1305H | Recombinant Human NKX3-1, GST-tagged | +Inquiry |
NKX3-1-10703M | Recombinant Mouse NKX3-1 Protein | +Inquiry |
NKX3-1-6706HF | Recombinant Full Length Human NKX3-1 Protein, GST-tagged | +Inquiry |
NKX3-1-469H | Recombinant Human NKX3-1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NKX3-1-6087M | Recombinant Mouse NKX3-1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX3-1 Products
Required fields are marked with *
My Review for All NKX3-1 Products
Required fields are marked with *