Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human NKX3-1

Cat.No. : NKX3-1-28096TH
Product Overview : Recombinant fragment of Human Nkx3.1 with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in the prostate and, at a lower level, in the testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIEL ERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT KRKQLSSELGDLEKHSSLPALKEEAFSRAS
Sequence Similarities : Belongs to the NK-3 homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name : NKX3-1 NK3 homeobox 1 [ Homo sapiens ]
Official Symbol : NKX3-1
Synonyms : NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1;
Gene ID : 4824
mRNA Refseq : NM_006167
Protein Refseq : NP_006158
MIM : 602041
Uniprot ID : Q99801
Chromosome Location : 8p21.2
Pathway : Coregulation of Androgen receptor activity, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem;
Function : androgen receptor activity; core promoter binding; contributes_to cysteine-type endopeptidase activator activity involved in apoptotic process; estrogen receptor activity; estrogen receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends