Recombinant Human NKX3-1

Cat.No. : NKX3-1-28096TH
Product Overview : Recombinant fragment of Human Nkx3.1 with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Highly expressed in the prostate and, at a lower level, in the testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIEL ERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT KRKQLSSELGDLEKHSSLPALKEEAFSRAS
Sequence Similarities : Belongs to the NK-3 homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name NKX3-1 NK3 homeobox 1 [ Homo sapiens ]
Official Symbol NKX3-1
Synonyms NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1;
Gene ID 4824
mRNA Refseq NM_006167
Protein Refseq NP_006158
MIM 602041
Uniprot ID Q99801
Chromosome Location 8p21.2
Pathway Coregulation of Androgen receptor activity, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem;
Function androgen receptor activity; core promoter binding; contributes_to cysteine-type endopeptidase activator activity involved in apoptotic process; estrogen receptor activity; estrogen receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX3-1 Products

Required fields are marked with *

My Review for All NKX3-1 Products

Required fields are marked with *

0
cart-icon