Recombinant Human NKX3-2 protein, His-tagged
| Cat.No. : | NKX3-2-215H |
| Product Overview : | Recombinant Human NKX3-2 protein(NP_001180)(1-333 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-333 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
| Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NKX3-2 NK3 homeobox 2 [ Homo sapiens ] |
| Official Symbol | NKX3-2 |
| Synonyms | NKX3-2; NK3 homeobox 2; bagpipe homeobox homolog 1 (Drosophila) , BAPX1; homeobox protein Nkx-3.2; NKX3.2; NKX3B; homeobox protein NK-3 homolog B; bagpipe homeobox protein homolog 1; SMMD; BAPX1; MGC138171; |
| Gene ID | 579 |
| mRNA Refseq | NM_001189 |
| Protein Refseq | NP_001180 |
| MIM | 602183 |
| UniProt ID | P78367 |
| ◆ Recombinant Proteins | ||
| NKX3-2-2159M | Recombinant Mouse NKX3-2 Protein (1-333 aa), His-SUMO-tagged | +Inquiry |
| NKX3-2-073H | Recombinant Human NKX3-2 protein, GST-tagged | +Inquiry |
| NKX3-2-215H | Recombinant Human NKX3-2 protein, His-tagged | +Inquiry |
| NKX3-2-5232H | Recombinant Human NKX3-2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Nkx3-2-690M | Recombinant Mouse Nkx3-2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX3-2 Products
Required fields are marked with *
My Review for All NKX3-2 Products
Required fields are marked with *



