Recombinant Mouse NKX3-2 Protein (1-333 aa), His-SUMO-tagged
Cat.No. : | NKX3-2-2159M |
Product Overview : | Recombinant Mouse NKX3-2 Protein (1-333 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-333 aa |
Description : | Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Nkx3-2 NK3 homeobox 2 [ Mus musculus ] |
Official Symbol | NKX3-2 |
Synonyms | NKX3-2; NK3 homeobox 2; homeobox protein Nkx-3.2; Bapx1; NKX3.2; Nkx-3.2; |
Gene ID | 12020 |
mRNA Refseq | NM_007524 |
Protein Refseq | NP_031550 |
UniProt ID | P97503 |
◆ Recombinant Proteins | ||
NKX3-2-215H | Recombinant Human NKX3-2 protein, His-tagged | +Inquiry |
NKX3-2-073H | Recombinant Human NKX3-2 protein, GST-tagged | +Inquiry |
NKX3-2-3038R | Recombinant Rhesus monkey NKX3-2 Protein, His-tagged | +Inquiry |
NKX3-2-2159M | Recombinant Mouse NKX3-2 Protein (1-333 aa), His-SUMO-tagged | +Inquiry |
Nkx3-2-690M | Recombinant Mouse Nkx3-2 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKX3-2 Products
Required fields are marked with *
My Review for All NKX3-2 Products
Required fields are marked with *
0
Inquiry Basket