Recombinant Mouse NKX3-2 Protein (1-333 aa), His-SUMO-tagged

Cat.No. : NKX3-2-2159M
Product Overview : Recombinant Mouse NKX3-2 Protein (1-333 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 1-333 aa
Description : Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 53.7 kDa
AA Sequence : MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Nkx3-2 NK3 homeobox 2 [ Mus musculus ]
Official Symbol NKX3-2
Synonyms NKX3-2; NK3 homeobox 2; homeobox protein Nkx-3.2; Bapx1; NKX3.2; Nkx-3.2;
Gene ID 12020
mRNA Refseq NM_007524
Protein Refseq NP_031550
UniProt ID P97503

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX3-2 Products

Required fields are marked with *

My Review for All NKX3-2 Products

Required fields are marked with *

0
cart-icon
0
compare icon