Recombinant Human NKX6-2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NKX6-2-4929H
Product Overview : NKX6 MS Standard C13 and N15-labeled recombinant protein (NP_796374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NKX6-2 (NK6 Homeobox 2) is a Protein Coding gene. Diseases associated with NKX6-2 include Spastic Ataxia 8, Autosomal Recessive, With Hypomyelinating Leukodystrophy and Spastic Ataxia 8. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and sequence-specific DNA binding. An important paralog of this gene is NKX6-1.
Molecular Mass : 29.1 kDa
AA Sequence : MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDALTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NKX6-2 NK6 homeobox 2 [ Homo sapiens (human) ]
Official Symbol NKX6-2
Synonyms NKX6-2; NK6 homeobox 2; NK6 transcription factor related, locus 2 (Drosophila); homeobox protein Nkx-6.2; GTX; NKX6.1; NKX6B; homeobox 6B; NK homeobox family 6, B; homeobox protein NK-6 homolog B; NK6 transcription factor related, locus 2; glial and testis-specific homeobox protein; NKX6.2; MGC126684;
Gene ID 84504
mRNA Refseq NM_177400
Protein Refseq NP_796374
MIM 605955
UniProt ID Q9C056

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX6-2 Products

Required fields are marked with *

My Review for All NKX6-2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon