Recombinant Human NKX6-2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NKX6-2-4929H |
| Product Overview : | NKX6 MS Standard C13 and N15-labeled recombinant protein (NP_796374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | NKX6-2 (NK6 Homeobox 2) is a Protein Coding gene. Diseases associated with NKX6-2 include Spastic Ataxia 8, Autosomal Recessive, With Hypomyelinating Leukodystrophy and Spastic Ataxia 8. Gene Ontology (GO) annotations related to this gene include DNA-binding transcription factor activity and sequence-specific DNA binding. An important paralog of this gene is NKX6-1. |
| Molecular Mass : | 29.1 kDa |
| AA Sequence : | MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGAPWRDPRLAGPAPAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDALTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NKX6-2 NK6 homeobox 2 [ Homo sapiens (human) ] |
| Official Symbol | NKX6-2 |
| Synonyms | NKX6-2; NK6 homeobox 2; NK6 transcription factor related, locus 2 (Drosophila); homeobox protein Nkx-6.2; GTX; NKX6.1; NKX6B; homeobox 6B; NK homeobox family 6, B; homeobox protein NK-6 homolog B; NK6 transcription factor related, locus 2; glial and testis-specific homeobox protein; NKX6.2; MGC126684; |
| Gene ID | 84504 |
| mRNA Refseq | NM_177400 |
| Protein Refseq | NP_796374 |
| MIM | 605955 |
| UniProt ID | Q9C056 |
| ◆ Recombinant Proteins | ||
| NKX6-2-2858R | Recombinant Rhesus Macaque NKX6-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Nkx6-2-1076M | Recombinant Mouse Nkx6-2 Protein, MYC/DDK-tagged | +Inquiry |
| NKX6-2-3632H | Recombinant Human NKX6-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NKX6-2-3039R | Recombinant Rhesus monkey NKX6-2 Protein, His-tagged | +Inquiry |
| NKX6-2-5906H | Recombinant Human NKX6-2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX6-2 Products
Required fields are marked with *
My Review for All NKX6-2 Products
Required fields are marked with *
