Recombinant Human NKX6-2 Protein, GST-tagged
Cat.No. : | NKX6-2-5906H |
Product Overview : | Human NKX6-2 partial ORF ( NP_796374, 168 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 168-277 a.a. |
Description : | NKX6-2 (NK6 Homeobox 2) is a Protein Coding gene. Diseases associated with NKX6-2 include Spastic Ataxia 8, Autosomal Recessive, With Hypomyelinating Leukodystrophy and Non-Functioning Pancreatic Endocrine Tumor. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is NKX6-1. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | EQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKX6-2 NK6 homeobox 2 [ Homo sapiens ] |
Official Symbol | NKX6-2 |
Synonyms | NKX6-2; NK6 homeobox 2; NK6 transcription factor related, locus 2 (Drosophila); homeobox protein Nkx-6.2; GTX; NKX6.1; NKX6B; homeobox 6B; NK homeobox family 6, B; homeobox protein NK-6 homolog B; NK6 transcription factor related, locus 2; glial and testis-specific homeobox protein; NKX6.2; MGC126684; |
Gene ID | 84504 |
mRNA Refseq | NM_177400 |
Protein Refseq | NP_796374 |
MIM | 605955 |
UniProt ID | Q9C056 |
◆ Recombinant Proteins | ||
NKX6-2-5906H | Recombinant Human NKX6-2 Protein, GST-tagged | +Inquiry |
NKX6-2-3632H | Recombinant Human NKX6-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NKX6-2-2851H | Recombinant Human NKX6-2 protein, His-tagged | +Inquiry |
Nkx6-2-1076M | Recombinant Mouse Nkx6-2 Protein, MYC/DDK-tagged | +Inquiry |
NKX6-2-4382C | Recombinant Chicken NKX6-2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX6-2 Products
Required fields are marked with *
My Review for All NKX6-2 Products
Required fields are marked with *