Recombinant Human NLGN4Y Protein, His-tagged

Cat.No. : NLGN4Y-24H
Product Overview : Recombinant human NLGN4Y protein with a His-tag was expressed in HEK293
Availability January 27, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : The protein has a calculated MW of 22.8 kDa.
AA Sequence : NYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFAHHHHHHHHHH
Endotoxin : <1 EU/μg
Purity : >95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.23 mg/mL
Storage Buffer : PBS, pH7.4, 0.05% SKL
Gene Name NLGN4Y neuroligin 4, Y-linked [ Homo sapiens (human) ]
Official Symbol NLGN4Y
Synonyms NLGN4Y; neuroligin 4, Y-linked; neuroligin 4, Y linked; neuroligin-4, Y-linked; KIAA0951;
Gene ID 22829
mRNA Refseq NM_001164238
Protein Refseq NP_001157710
MIM 400028
UniProt ID Q8NFZ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NLGN4Y Products

Required fields are marked with *

My Review for All NLGN4Y Products

Required fields are marked with *

0
cart-icon
0
compare icon