Recombinant Human NLRC4 Protein, GST-Tagged

Cat.No. : NLRC4-1317H
Product Overview : Human CARD12 partial ORF (AAH31555, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Molecular Mass : 36.63 kDa
AA Sequence : QESLQSVKNTTEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NLRC4 NLR family, CARD domain containing 4 [ Homo sapiens ]
Official Symbol NLRC4
Synonyms NLRC4; NLR family, CARD domain containing 4; CARD12, caspase recruitment domain family, member 12; NLR family CARD domain-containing protein 4; CLAN; CLAN1; CLANA; CLANB; CLANC; CLAND; CLR2.1; ipaf; NOD like receptor C4; nucleotide binding oligomerization domain; leucine rich repeat and CARD domain containing 4; NOD-like receptor C4; ICE-protease activating factor; ice protease-activating factor; CARD, LRR, and NACHT-containing protein; caspase recruitment domain family, member 12; caspase recruitment domain-containing protein 12; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4; IPAF; CARD12;
Gene ID 58484
mRNA Refseq NM_001199138
Protein Refseq NP_001186067
MIM 606831
UniProt ID Q9NPP4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NLRC4 Products

Required fields are marked with *

My Review for All NLRC4 Products

Required fields are marked with *

0
cart-icon