Recombinant Human NLRC4 Protein, GST-Tagged
Cat.No. : | NLRC4-1317H |
Product Overview : | Human CARD12 partial ORF (AAH31555, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the caspase recruitment domain-containing NLR family. Family members play essential roles in innate immune response to a wide range of pathogenic organisms, tissue damage and other cellular stresses. Mutations in this gene result in autoinflammation with infantile enterocolitis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | QESLQSVKNTTEQEILKAININSFVECGIHLYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NLRC4 NLR family, CARD domain containing 4 [ Homo sapiens ] |
Official Symbol | NLRC4 |
Synonyms | NLRC4; NLR family, CARD domain containing 4; CARD12, caspase recruitment domain family, member 12; NLR family CARD domain-containing protein 4; CLAN; CLAN1; CLANA; CLANB; CLANC; CLAND; CLR2.1; ipaf; NOD like receptor C4; nucleotide binding oligomerization domain; leucine rich repeat and CARD domain containing 4; NOD-like receptor C4; ICE-protease activating factor; ice protease-activating factor; CARD, LRR, and NACHT-containing protein; caspase recruitment domain family, member 12; caspase recruitment domain-containing protein 12; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 4; IPAF; CARD12; |
Gene ID | 58484 |
mRNA Refseq | NM_001199138 |
Protein Refseq | NP_001186067 |
MIM | 606831 |
UniProt ID | Q9NPP4 |
◆ Recombinant Proteins | ||
NLRC4-815H | Recombinant Human NLRC4 | +Inquiry |
NLRC4-10714M | Recombinant Mouse NLRC4 Protein | +Inquiry |
NLRC4-3639H | Recombinant Human NLRC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLRC4-1317H | Recombinant Human NLRC4 Protein, GST-Tagged | +Inquiry |
NLRC4-6093M | Recombinant Mouse NLRC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRC4-3805HCL | Recombinant Human NLRC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLRC4 Products
Required fields are marked with *
My Review for All NLRC4 Products
Required fields are marked with *
0
Inquiry Basket