Recombinant Human NLRP3 protein, GST-tagged
Cat.No. : | NLRP3-185H |
Product Overview : | Recombinant Human PNLRP3(1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-100 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIF AAINRRDLYEKAKRDEPKWGSDNAR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | NLRP3 NLR family, pyrin domain containing 3 [ Homo sapiens ] |
Official Symbol | NLRP3 |
Synonyms | NLRP3; NLR family, pyrin domain containing 3; C1orf7, CIAS1, cold autoinflammatory syndrome 1; NACHT, LRR and PYD domains-containing protein 3; AGTAVPRL; AII; AVP; CLR1.1; Cryopyrin; FCAS; FCU; MWS; NALP3; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 3; PYPAF1; cryopyrin; caterpiller protein 1.1; PYRIN-containing APAF1-like protein 1; NACHT, LRR and PYD containing protein 3; cold autoinflammatory syndrome 1 protein; NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3; CIAS1; C1orf7; FLJ95925; |
Gene ID | 114548 |
mRNA Refseq | NM_004895 |
Protein Refseq | NP_004886 |
MIM | 606416 |
UniProt ID | Q96P20 |
Chromosome Location | 1q44 |
Pathway | Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem; |
Function | ATP binding; nucleotide binding; peptidoglycan binding; protein binding; |
◆ Recombinant Proteins | ||
NLRP3-02H | Recombinant Human NLRP3 Protein, Myc/DDK-tagged | +Inquiry |
NLRP3-10722M | Recombinant Mouse NLRP3 Protein | +Inquiry |
NLRP3-10722ME | Recombinant Mouse NLRP3 Protein, His tagged | +Inquiry |
NLRP3-3003H | Recombinant Human NLRP3 protein, His-SUMO-tagged | +Inquiry |
NLRP3-4645H | Recombinant Human NLRP3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRP3-3799HCL | Recombinant Human NLRP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLRP3 Products
Required fields are marked with *
My Review for All NLRP3 Products
Required fields are marked with *