Recombinant Human NLRP3 protein, GST-tagged

Cat.No. : NLRP3-185H
Product Overview : Recombinant Human PNLRP3(1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-100 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIF AAINRRDLYEKAKRDEPKWGSDNAR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name NLRP3 NLR family, pyrin domain containing 3 [ Homo sapiens ]
Official Symbol NLRP3
Synonyms NLRP3; NLR family, pyrin domain containing 3; C1orf7, CIAS1, cold autoinflammatory syndrome 1; NACHT, LRR and PYD domains-containing protein 3; AGTAVPRL; AII; AVP; CLR1.1; Cryopyrin; FCAS; FCU; MWS; NALP3; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 3; PYPAF1; cryopyrin; caterpiller protein 1.1; PYRIN-containing APAF1-like protein 1; NACHT, LRR and PYD containing protein 3; cold autoinflammatory syndrome 1 protein; NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3; CIAS1; C1orf7; FLJ95925;
Gene ID 114548
mRNA Refseq NM_004895
Protein Refseq NP_004886
MIM 606416
UniProt ID Q96P20
Chromosome Location 1q44
Pathway Immune System, organism-specific biosystem; Inflammasomes, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Innate Immune System, organism-specific biosystem; NOD-like receptor signaling pathway, organism-specific biosystem; NOD-like receptor signaling pathway, conserved biosystem;
Function ATP binding; nucleotide binding; peptidoglycan binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NLRP3 Products

Required fields are marked with *

My Review for All NLRP3 Products

Required fields are marked with *

0
cart-icon