Recombinant Human NLRX1 protein, His-tagged
Cat.No. : | NLRX1-1309H |
Product Overview : | Recombinant Human NLRX1 protein(359-708 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 359-708 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EAVAQAMVLEMFREEDYYNDDVLDQMGASILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTEAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLQGVAIQMCWKLPLLPYAHLWTPRMPSHWCFLLILMPPLPQWYDGLVAPRGRCT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NLRX1 NLR family member X1 [ Homo sapiens ] |
Official Symbol | NLRX1 |
Synonyms | http://www.ncbi.nlm.nih.gov/gene/79671 |
Gene ID | 79671 |
mRNA Refseq | NM_170722.1 |
Protein Refseq | NP_733840.1 |
MIM | 611947 |
UniProt ID | Q86UT6 |
◆ Recombinant Proteins | ||
NLRX1-4001R | Recombinant Rat NLRX1 Protein | +Inquiry |
NLRX1-6104M | Recombinant Mouse NLRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NLRX1-1308H | Recombinant Human NLRX1, GST-tagged | +Inquiry |
NLRX1-1309H | Recombinant Human NLRX1 protein, His-tagged | +Inquiry |
NLRX1-10734M | Recombinant Mouse NLRX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRX1-3796HCL | Recombinant Human NLRX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLRX1 Products
Required fields are marked with *
My Review for All NLRX1 Products
Required fields are marked with *
0
Inquiry Basket