Recombinant Human NME1 protein, GST-tagged
| Cat.No. : | NME1-1310H |
| Product Overview : | Recombinant Human NME1 protein(1-152 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-152 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | NME1 non-metastatic cells 1, protein (NM23A) expressed in [ Homo sapiens ] |
| Official Symbol | NME1 |
| Synonyms | NME1; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; NM23; NM23 H1; NDP kinase A; granzyme A-activated DNase; metastasis inhibition factor nm23; tumor metastatic process-associated protein; NB; AWD; NBS; GAAD; NDKA; NDPKA; NDPK-A; NM23-H1; |
| mRNA Refseq | NM_000269 |
| Protein Refseq | NP_000260 |
| MIM | 156490 |
| UniProt ID | P15531 |
| Gene ID | 4830 |
| ◆ Recombinant Proteins | ||
| NME1-5510H | Recombinant Human NME1 protein, His-tagged | +Inquiry |
| NME1-28097TH | Recombinant Human NME1 | +Inquiry |
| NME1-478H | Recombinant Human NME1 protein, His-tagged | +Inquiry |
| NME1-4003R | Recombinant Rat NME1 Protein | +Inquiry |
| NME1-192H | Active Recombinant Human NME1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NME1-3792HCL | Recombinant Human NME1 293 Cell Lysate | +Inquiry |
| NME1-256HKCL | Human NME1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME1 Products
Required fields are marked with *
My Review for All NME1 Products
Required fields are marked with *
