Recombinant Human NME7 protein, GST-tagged
| Cat.No. : | NME7-301365H |
| Product Overview : | Recombinant Human NME7 (1-90 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Ala90 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens ] |
| Official Symbol | NME7 |
| Synonyms | NME7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 7; FLJ37194; NM23 H7; NDK 7; NDP kinase 7; nucleoside-diphosphate kinase 7; MN23H7; nm23-H7; |
| Gene ID | 29922 |
| mRNA Refseq | NM_013330 |
| Protein Refseq | NP_037462 |
| MIM | 613465 |
| UniProt ID | Q9Y5B8 |
| ◆ Recombinant Proteins | ||
| NME7-301365H | Recombinant Human NME7 protein, GST-tagged | +Inquiry |
| Nme7-4440M | Recombinant Mouse Nme7 Protein, Myc/DDK-tagged | +Inquiry |
| NME7-9244HFL | Recombinant Full Length Human NME7, Flag-tagged | +Inquiry |
| NME7-8570Z | Recombinant Zebrafish NME7 | +Inquiry |
| NME7-4005R | Recombinant Rat NME7 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NME7-3786HCL | Recombinant Human NME7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME7 Products
Required fields are marked with *
My Review for All NME7 Products
Required fields are marked with *
