Recombinant Human NME7 protein, GST-tagged

• Cat.No.: NME7-301365H
• Product Overview: Recombinant Human NME7 (1-90 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ala90
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: NME7 non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens ]
• Official Symbol: NME7
• Synonyms: NME7; non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 7; FLJ37194; NM23 H7; NDK 7; NDP kinase 7; nucleoside-diphosphate kinase 7; MN23H7; nm23-H7
• Gene ID: 29922
• mRNA Refseq: NM_013330
• Protein Refseq: NP_037462
• MIM: 613465
• UniProt ID: Q9Y5B8