Recombinant Human NMRK1 Protein, GST-tagged
| Cat.No. : | NMRK1-5169H |
| Product Overview : | Human C9orf95 full-length ORF ( NP_060351.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 49.6 kDa |
| AA Sequence : | MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NMRK1 nicotinamide riboside kinase 1 [ Homo sapiens (human) ] |
| Official Symbol | NMRK1 |
| Synonyms | C9orf95; NMRK1; nicotinamide riboside kinase 1; NRK1; C9orf95; bA235O14.2; nicotinamide riboside kinase 1; NRK 1; RNK 1; nicotinic acid riboside kinase 1; nmR-K 1; ribosylnicotinamide kinase 1; ribosylnicotinic acid kinase 1; EC 2.7.1.173; EC 2.7.1.22 |
| Gene ID | 54981 |
| mRNA Refseq | NM_001127603 |
| Protein Refseq | NP_001121075 |
| MIM | 608704 |
| UniProt ID | Q9NWW6 |
| ◆ Recombinant Proteins | ||
| NMRK1-3666R | Recombinant Rat NMRK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NMRK1-4007R | Recombinant Rat NMRK1 Protein | +Inquiry |
| NMRK1-3059R | Recombinant Rhesus monkey NMRK1 Protein, His-tagged | +Inquiry |
| NMRK1-2140Z | Recombinant Zebrafish NMRK1 | +Inquiry |
| NMRK1-5169H | Recombinant Human NMRK1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NMRK1-7918HCL | Recombinant Human C9orf95 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMRK1 Products
Required fields are marked with *
My Review for All NMRK1 Products
Required fields are marked with *
