Recombinant Human NMU, His-tagged

• Cat.No.: NMU-34H
• Product Overview: A DNA sequence encoding human neuromedin-U (P48645) corresponding to amino acid (1-174) was expressed with a C-terminal polyhistidine tag.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-174 a.a.
• Form: PBS pH7.4
• Molecular Mass: The mature form of human neuromedin-U consists of 140 amino acids and has a predicted molecular mass of 16kDa.
• AA Sequence: MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQAS NALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQS PFASQSRGYFLFRPRNGRRSAGFI
• Purity: >90% as determined by SDS-PAGE
• Storage: Store it at +4°C for short term. For long term storage, store it at -20°C - -70°C. Avoid freeze-thaw cycles.

Gene Information

• Gene Name: NMU neuromedin U [ Homo sapiens ]
• Official Symbol: NMU
• Synonyms: NMU; neuromedin U; neuromedin-U
• Gene ID: 10874
• mRNA Refseq: NM_006681
• Protein Refseq: NP_006672
• MIM: 605103
• UniProt ID: P48645
• Chromosome Location: 4q12
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem
• Function: neuromedin U receptor binding; receptor binding