Recombinant Human NMU, His-tagged
Cat.No. : | NMU-34H |
Product Overview : | A DNA sequence encoding human neuromedin-U (P48645) corresponding to amino acid (1-174) was expressed with a C-terminal polyhistidine tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-174 a.a. |
Form : | PBS pH7.4 |
Molecular Mass : | The mature form of human neuromedin-U consists of 140 amino acids and has a predicted molecular mass of 16kDa. |
AA Sequence : | MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQAS NALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQS PFASQSRGYFLFRPRNGRRSAGFI |
Purity : | >90% as determined by SDS-PAGE |
Storage : | Store it at +4°C for short term. For long term storage, store it at -20°C - -70°C. Avoid freeze-thaw cycles. |
Gene Name | NMU neuromedin U [ Homo sapiens ] |
Official Symbol | NMU |
Synonyms | NMU; neuromedin U; neuromedin-U; |
Gene ID | 10874 |
mRNA Refseq | NM_006681 |
Protein Refseq | NP_006672 |
MIM | 605103 |
UniProt ID | P48645 |
Chromosome Location | 4q12 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem; |
Function | neuromedin U receptor binding; receptor binding; |
◆ Recombinant Proteins | ||
NMU-3669R | Recombinant Rat NMU Protein, His (Fc)-Avi-tagged | +Inquiry |
NMU-3645H | Recombinant Human NMU Protein, His (Fc)-Avi-tagged | +Inquiry |
NMU-3940H | Recombinant Human NMU Protein (Ala35-Ile174), N-GST tagged | +Inquiry |
NMU-34H | Recombinant Human NMU, His-tagged | +Inquiry |
NMU-741H | Recombinant Human NMU | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMU-3781HCL | Recombinant Human NMU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NMU Products
Required fields are marked with *
My Review for All NMU Products
Required fields are marked with *