Recombinant Human NNAT

• Cat.No.: NNAT-29654TH
• Product Overview: Recombinant full length Human Neuronatin with a proprietary tag; Predicted MWt 34.65 kDa including tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 81 amino acids
• Description: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.
• Molecular Weight: 34.650kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
• Sequence Similarities: Belongs to the neuronatin family.

Gene Information

• Gene Name: NNAT neuronatin [ Homo sapiens ]
• Official Symbol: NNAT
• Synonyms: NNAT; neuronatin; Peg5
• Gene ID: 4826
• mRNA Refseq: NM_005386
• Protein Refseq: NP_005377
• MIM: 603106
• Uniprot ID: Q16517
• Chromosome Location: 20q11.2-q12