Recombinant Human NOC3L Protein, GST-tagged
Cat.No. : | NOC3L-416H |
Product Overview : | Human C10orf117 partial ORF ( NP_071896, 702 a.a. - 800 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOC3L nucleolar complex associated 3 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | NOC3L |
Synonyms | NOC3L; nucleolar complex associated 3 homolog (S. cerevisiae); C10orf117, chromosome 10 open reading frame 117; nucleolar complex protein 3 homolog; AD24; FAD24; FLJ12820; NOC3-like protein; NOC3 protein homolog; factor for adipocyte differentiation 24; nucleolar complex-associated protein 3-like protein; C10orf117; |
Gene ID | 64318 |
mRNA Refseq | NM_022451 |
Protein Refseq | NP_071896 |
MIM | 610769 |
UniProt ID | Q8WTT2 |
◆ Recombinant Proteins | ||
NOC3L-10763M | Recombinant Mouse NOC3L Protein | +Inquiry |
NOC3L-416H | Recombinant Human NOC3L Protein, GST-tagged | +Inquiry |
NOC3L-6126M | Recombinant Mouse NOC3L Protein, His (Fc)-Avi-tagged | +Inquiry |
NOC3L-851Z | Recombinant Zebrafish NOC3L | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOC3L Products
Required fields are marked with *
My Review for All NOC3L Products
Required fields are marked with *
0
Inquiry Basket