Recombinant Human NOC3L Protein, GST-tagged

• Cat.No.: NOC3L-416H
• Product Overview: Human C10orf117 partial ORF ( NP_071896, 702 a.a. - 800 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOC3L nucleolar complex associated 3 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: NOC3L
• Synonyms: NOC3L; nucleolar complex associated 3 homolog (S. cerevisiae); C10orf117, chromosome 10 open reading frame 117; nucleolar complex protein 3 homolog; AD24; FAD24; FLJ12820; NOC3-like protein; NOC3 protein homolog; factor for adipocyte differentiation 24; nucleolar complex-associated protein 3-like protein; C10orf117
• Gene ID: 64318
• mRNA Refseq: NM_022451
• Protein Refseq: NP_071896
• MIM: 610769
• UniProt ID: Q8WTT2