Recombinant Human NOC3L Protein, GST-tagged

Cat.No. : NOC3L-416H
Product Overview : Human C10orf117 partial ORF ( NP_071896, 702 a.a. - 800 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : PIVQRFAAHLIAGAPSEGSGALKPELSRRSATELFEAYSMAEMTFNPPVESSNPKIKGKFLQGDSFLNEDLNQLIKRYSSEVATESPLDFTKYLKTSLH
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOC3L nucleolar complex associated 3 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol NOC3L
Synonyms NOC3L; nucleolar complex associated 3 homolog (S. cerevisiae); C10orf117, chromosome 10 open reading frame 117; nucleolar complex protein 3 homolog; AD24; FAD24; FLJ12820; NOC3-like protein; NOC3 protein homolog; factor for adipocyte differentiation 24; nucleolar complex-associated protein 3-like protein; C10orf117;
Gene ID 64318
mRNA Refseq NM_022451
Protein Refseq NP_071896
MIM 610769
UniProt ID Q8WTT2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOC3L Products

Required fields are marked with *

My Review for All NOC3L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon