Recombinant Human NOD2 Protein, His-tagged

Cat.No. : NOD2-25H
Product Overview : Recombinant Human NOD2 Protein(92-193 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 92-193 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKAN
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol NOD2
Synonyms NOD2; nucleotide-binding oligomerization domain containing 2; CARD15, caspase recruitment domain family, member 15 , IBD1; nucleotide-binding oligomerization domain-containing protein 2; BLAU; CD; CLR16.3; NLR family; CARD domain containing 2; NLRC2; NOD like receptor C2; nucleotide binding oligomerization domain; leucine rich repeat and CARD domain containing 2; PSORAS1; NOD-like receptor C2; NLR family, CARD domain containing 2; inflammatory bowel disease protein 1; caspase recruitment domain protein 15; nucleotide-binding oligomerization domain 2; caspase recruitment domain family, member 15; caspase recruitment domain-containing protein 15; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 2; ACUG; IBD1; NOD2B; CARD15;
Gene ID 64127
mRNA Refseq NM_022162
Protein Refseq NP_071445
MIM 605956
UniProt ID Q9HC29

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOD2 Products

Required fields are marked with *

My Review for All NOD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon