Recombinant Human NOD2 Protein, His-tagged

• Cat.No.: NOD2-25H
• Product Overview: Recombinant Human NOD2 Protein(92-193 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 92-193 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKAN
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NOD2
• Synonyms: NOD2; nucleotide-binding oligomerization domain containing 2; CARD15, caspase recruitment domain family, member 15 , IBD1; nucleotide-binding oligomerization domain-containing protein 2; BLAU; CD; CLR16.3; NLR family; CARD domain containing 2; NLRC2; NOD like receptor C2; nucleotide binding oligomerization domain; leucine rich repeat and CARD domain containing 2; PSORAS1; NOD-like receptor C2; NLR family, CARD domain containing 2; inflammatory bowel disease protein 1; caspase recruitment domain protein 15; nucleotide-binding oligomerization domain 2; caspase recruitment domain family, member 15; caspase recruitment domain-containing protein 15; nucleotide-binding oligomerization domain, leucine rich repeat and CARD domain containing 2; ACUG; IBD1; NOD2B; CARD15
• Gene ID: 64127
• mRNA Refseq: NM_022162
• Protein Refseq: NP_071445
• MIM: 605956
• UniProt ID: Q9HC29