Recombinant Human NOG protein(28-232 aa), N-MBP & C-His-tagged
| Cat.No. : | NOG-2849H |
| Product Overview : | Recombinant Human NOG protein(Q13253)(28-232 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His&MBP |
| Protein Length : | 28-232 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Gene Name | NOG noggin [ Homo sapiens ] |
| Official Symbol | NOG |
| Synonyms | NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1; |
| Gene ID | 9241 |
| mRNA Refseq | NM_005450 |
| Protein Refseq | NP_005441 |
| MIM | 602991 |
| UniProt ID | Q13253 |
| ◆ Recombinant Proteins | ||
| Nog-1770M | Recombinant Mouse Noggin | +Inquiry |
| NOG-1423H | Recombinant Human NOG protein, His-GST & Myc-tagged | +Inquiry |
| Nog-019N | Active Recombinant Mouse Nog Protein (206 aa) | +Inquiry |
| NOG-29H | Active Recombinant Human NOG Protein, Pre-aliquoted | +Inquiry |
| Nog-4452M | Active Recombinant Mouse Nog Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
