Recombinant Human NOG protein
Cat.No. : | NOG-293H |
Product Overview : | Recombinant Human NOG protein was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Non |
Protein Length : | 205 |
Description : | Noggin encoded by the NOG gene, was first isolated from Xenopus, having the function of inducing secondary axis formation in frog embryos. It inhibits TGF-β family ligands and preventing them from binding to their corresponding receptors. Noggin was originally found as a BMP-4 antagonist, and then has been shown to modulate the activities of other BMPs (BMP-2, 7, 13 and 14). Additionally, it has pleiotropic effect, both in early development and later stages. The results of the mouse knockout of noggin suggest that it is involved in numerous developmental processes, such as neural tube fusion and joint formation. In recent report, proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) have relation with the mutant of evolutionarily conserved amino acid residues of Noggin. Mature human Noggin shares 99 %, 99 %, 98 %, 97 % and 89 % a.a. sequence identity with mouse, rat, bovine, equine and chicken Noggin, respectively. |
Form : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4, 5% trehalose, 0.02% Tween-20. |
Bio-activity : | Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.04‑0.2 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP‑4. |
Molecular Mass : | Approximately 23.0 kDa on SDS-PAGE under reducing conditions, containing 205 amino acids, and a molecular mass about 47.9 kDa homodimer under non-reducing conditions (Molecular size on SDS-PAGE will appear at approximately 50-80 kDa). |
AA Sequence : | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Endotoxin : | Less than 0.1 EU/μg of rHuNoggin, Insect Cell as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | NOG |
Official Symbol | NOG |
Synonyms | SYM1; SYNS1; SYNS1A |
Gene ID | 9241 |
mRNA Refseq | NM_005450.6 |
Protein Refseq | NP_005441.1 |
MIM | 602991 |
UniProt ID | Q13253 |
◆ Recombinant Proteins | ||
NOG-454H | Recombinant Human Noggin | +Inquiry |
NOG-223H | Recombinant Human NOG, StrepII-tagged | +Inquiry |
NOG-30336TH | Recombinant Human NOG | +Inquiry |
NOG-6681HF | Recombinant Full Length Human NOG Protein, GST-tagged | +Inquiry |
NOG-3827H | Recombinant Human NOG protein, Fc-tagged, For Organoid Culture | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
0
Inquiry Basket